Sequence (fasta): 1n5nDownload

>1N5NA:Peptide deformylase
MGSDKIHHHHHHMAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLA
ATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPLTEEMDQYQEGCLSVPGFYENVDRPQKV
RIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEKQHRQQA
>1N5NB:Peptide deformylase
MGSDKIHHHHHHMAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLA
ATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPLTEEMDQYQEGCLSVPGFYENVDRPQKV
RIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEKQHRQQA