Sequence (fasta): 1m6cDownload

>1M6CA:PROTEIN (MYOGLOBIN)
GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED
LKKHGNTNLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP
GDFGADAQGAMSKALELFRNDMAAKYKELGFQG
>1M6CB:PROTEIN (MYOGLOBIN)
GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASED
LKKHGNTNLTALGGILKKKGHHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP
GDFGADAQGAMSKALELFRNDMAAKYKELGFQG