Sequence (fasta): 1m11Download

>1M11R:decay-accelerating factor
DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFC
NRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTA
VEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWS
DPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEG
EWS
>1M111:COAT PROTEIN VP1
GDTETAIDNAIARVADTVASGPSNSTSIPALTAVETGHTSQVEPSDTMQTRHVKNYHSRS
ESTVENFLSRSACVYIEEYYTKDQDNVNRYMSWTINARRMVQLRRKFELFTYMRFDMEIT
FVITSRQLPGTSIAQDMPPLTHQIMYIPPGGPVPNSVTDFAWQTSTNPSIFWTEGNAPPR
MSIPFISIGNAYSNFYDGWSHFSQNGVYGYNALNNMGKLYARHVNKDTPYQMSSTIRVYF
KPKHIRVWVPRPPRLSPYIKSSNVNFNPTNLTDERSSI
>1M112:COAT PROTEIN VP2
GYSDRVRSLTLGNSTITTQESANVVVGYGRWPEYLRDDEATAEDQPTQPDVATCRFYTLE
SVQWEKNSAGWWWKFPEALKDMGLFGQNMLYHYLGRAGYTIHVQCNASKFHQGCLLVVCV
PEAEMGCSQTDKEVAAMNLTKGEAAHKFEPTKTTGEHTVQSIVCNAGMGVGVGNLTIYPH
QWINLRTNNCATIVMPYVNSVPMDNMFRHYNFTLMVIPFAPLDYAAQASEYVPVTVTIAP
MCAEYNGLRLAYQQ
>1M113:COAT PROTEIN VP3
GFPVLNTPGSNQFMTSDDFQSPSAMPQFDVTPHMDIPGEVHNLMEIAEVDSVVPVNNIKV
NLQSMDAYHIEVNTGNHQGEKIFAFQMQPGLESVFKRTLMGEILNYYAHWSGSIKLTFTF
CGSAMATGKLLLAYSPPGADVPATRKQAMLGTHMIWDIGLQSSCVLCIPWISQTHYRLVQ
QDEYTSAGNVTCWYQTGIVVPPGTPNKCVVLCFASACNDFSVRMLRDTPFIGQTALLQ