Sequence (fasta): 1loaDownload

>1LOAA:LEGUME ISOLECTIN I (ALPHA CHAIN)
TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNV
ANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEF
DTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEANVVIAFNAATNVLTVSLTYP
N
>1LOAC:LEGUME ISOLECTIN I (ALPHA CHAIN)
TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNV
ANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEF
DTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEANVVIAFNAATNVLTVSLTYP
N
>1LOAE:LEGUME ISOLECTIN I (ALPHA CHAIN)
TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNV
ANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEF
DTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEANVVIAFNAATNVLTVSLTYP
N
>1LOAG:LEGUME ISOLECTIN I (ALPHA CHAIN)
TETTSFSITKFGPDQQNLIFQGDGYTTKERLTLTKAVRNTVGRALYSSPIHIWDSKTGNV
ANFVTSFTFVIDAPNSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKDYDKTSQTVAVEF
DTFYNTAWDPSNGDRHIGIDVNSIKSINTKSWALQNGKEANVVIAFNAATNVLTVSLTYP
N
>1LOAB:LEGUME ISOLECTIN I (BETA CHAIN)
ETSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSWYFHSELAGTSSS
>1LOAD:LEGUME ISOLECTIN I (BETA CHAIN)
ETSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSWYFHSELAGTSSS
>1LOAF:LEGUME ISOLECTIN I (BETA CHAIN)
ETSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSWYFHSELAGTSSS
>1LOAH:LEGUME ISOLECTIN I (BETA CHAIN)
ETSYTLNEVVPLKEFVPEWVRIGFSATTGAEFAAHEVLSWYFHSELAGTSSS