Sequence (fasta): 1lhiDownload

>1LHIA:HUMAN LYSOZYME
KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQIN
SRYWCNDGKTGGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRD
VRQYVQGCGV