Sequence (fasta): 1hovDownload

>1HOVA:MATRIX METALLOPROTEINASE-2
MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEAD
IMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTNTSANYSLFLVAAH
EFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYG