Sequence (fasta): 1g7aDownload

>1G7AA:INSULIN A-CHAIN
GIVEQCCTSICSLYQLENYCN
>1G7AC:INSULIN A-CHAIN
GIVEQCCTSICSLYQLENYCN
>1G7AE:INSULIN A-CHAIN
GIVEQCCTSICSLYQLENYCN
>1G7AG:INSULIN A-CHAIN
GIVEQCCTSICSLYQLENYCN
>1G7AB:INSULIN B-CHAIN
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
>1G7AD:INSULIN B-CHAIN
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
>1G7AF:INSULIN B-CHAIN
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
>1G7AH:INSULIN B-CHAIN
FVNQHLCGSHLVEALYLVCGERGFFYTPKT