Sequence (fasta): 1g17Download

>1G17A:RAS-RELATED PROTEIN SEC4
DSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQIWDTA
GQERFRTITTAYYRGAMGIILVYDITDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDM
ETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSN
>1G17B:RAS-RELATED PROTEIN SEC4
DSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQIWDTA
GQERFRTITTAYYRGAMGIILVYDITDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDM
ETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDSN