Sequence (fasta): 1ehwDownload

>1EHWA:NUCLEOSIDE DIPHOSPHATE KINASE
MGSSHHHHHHSSGLVPRGSHMGTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKM
LQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAA
PGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSW
>1EHWB:NUCLEOSIDE DIPHOSPHATE KINASE
MGSSHHHHHHSSGLVPRGSHMGTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKM
LQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAA
PGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSW