Sequence (fasta): 1e6jDownload

>1E6JH:IMMUNOGLOBULIN
EVQLQQSGAELARPGASVKMSCKASGYTFTSYTMHWVKQRPGQGLEWIGYINPSSGYSNY
NQKFKDKATLTADKSSSTAYMQLSSLTSEDSAVYYCSRPVVRLGYNFDYWGQGSTLTVSS
AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSD
LYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
>1E6JL:IMMUNOGLOBULIN
EIVLTQSPAITAASLGQKVTITCSASSSVSYMHWYQQKSGTSPKPWIYEISKLASGVPAR
FSGSGSGTSYSLTISSMEAEDAAIYYCQQWNYPFTFGSGTKLEIKRADAAPTVSIFPPSS
EQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLT
KDEYERHNSYTCEATHKTSTSPIVKSFNRN
>1E6JP:CAPSID PROTEIN P24
VHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLK
ETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIY
KRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLL
VQNANPDCKTILKALGPAATLEEMMTACQG