Sequence (fasta): 1dz5Download

>1DZ5A:U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKE
VSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFV
>1DZ5B:U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKE
VSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFV
>1DZ5C:PIE, RNA (5'-R(*GP*AP*GP*AP*CP*AP*UP*UP*GP*CP*AP*CP*CP* CP*GP*GP*AP*GP*UP*CP*UP*C)-3')
GAGACAUUGCACCCGGAGUCUC
>1DZ5D:PIE, RNA (5'-R(*GP*AP*GP*AP*CP*AP*UP*UP*GP*CP*AP*CP*CP* CP*GP*GP*AP*GP*UP*CP*UP*C)-3')
GAGACAUUGCACCCGGAGUCUC