Sequence (fasta): 1bahDownload

>1BAHA:CHARYBDOTOXIN
EFTNVSCTTSKEAWSVCQRLHNTSRGKCMNKKARCYS