Sequence (fasta): 1gsfDownload

>1GSFA:GLUTATHIONE TRANSFERASE A1-1
AEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEID
GMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKL
ALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLL
KALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF
>1GSFB:GLUTATHIONE TRANSFERASE A1-1
AEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEID
GMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKL
ALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLL
KALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF
>1GSFC:GLUTATHIONE TRANSFERASE A1-1
AEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEID
GMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKL
ALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLL
KALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF
>1GSFD:GLUTATHIONE TRANSFERASE A1-1
AEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEID
GMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKL
ALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLL
KALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF