[English] 日本語

Yorodumi

- PDB-4xwo: Structure of Get3 bound to the transmembrane domain of Sec22 -

+
Open data

-
Basic information

Entry

Database: PDB / ID: 4xwo

Title

Structure of Get3 bound to the transmembrane domain of Sec22

Components

ATPase GET3
Antibody heavy chainImmunoglobulin heavy chain
Antibody light chainImmunoglobulin light chain
Sec22

Keywords

HYDROLASE/TRANSPORT PROTEIN /

membrane protein targeting complex / HYDROLASE-TRANSPORT PROTEIN complex

Function / homology

Function and homology information

pheromone-dependent signal transduction involved in conjugation with cellular fusion / GET complex / tail-anchored membrane protein insertion into ER membrane /

Hydrolases; Acting on acid anhydrides / protein insertion into ER membrane /

post-translational protein targeting to endoplasmic reticulum membrane / response to arsenic-containing substance / retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum / response to metal ion / protein folding chaperone ...
Similarity search - Function

Biological species

Saccharomyces cerevisiae (brewer's yeast)

HOMO SAPIENS (human)
synthetic construct (others)

Method

X-RAY DIFFRACTION /

SYNCHROTRON /

MOLECULAR REPLACEMENT / Resolution: 2.75 Å

Authors

Mateja, A. / Paduch, M. / Chang, H.-Y. / Szydlowska, A. / Kossiakoff, A.A. / Hegde, R.S. / Keenan, R.J.

Funding support

United States, 3items

Organization	Grant number	Country
National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)	R01 GM086487	United States
National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)	U01 GM094588	United States
National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)	U54 GM087519	United States

Citation

Journal: Science / Year: 2015
Title: Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo.
Authors: Mateja, A. / Paduch, M. / Chang, H.Y. / Szydlowska, A. / Kossiakoff, A.A. / Hegde, R.S. / Keenan, R.J.

History

Deposition	Jan 29, 2015	Deposition site: RCSB / Processing site: RCSB
Revision 1.0	Mar 25, 2015	Provider: repository / Type: Initial release
Revision 1.1	Sep 20, 2017	Group: Author supporting evidence / Database references ...Author supporting evidence / Database references / Derived calculations / Source and taxonomy Category: citation / entity_src_gen ...citation / entity_src_gen / pdbx_audit_support / pdbx_struct_oper_list Item: _citation.journal_id_CSD / _entity_src_gen.pdbx_alt_source_flag ..._citation.journal_id_CSD / _entity_src_gen.pdbx_alt_source_flag / _pdbx_audit_support.funding_organization / _pdbx_struct_oper_list.symmetry_operation
Revision 1.2	Dec 25, 2019	Group: Author supporting evidence / Category: pdbx_audit_support / Item: _pdbx_audit_support.funding_organization
Revision 1.3	Sep 27, 2023	Group: Data collection / Database references ...Data collection / Database references / Derived calculations / Refinement description Category: chem_comp_atom / chem_comp_bond ...chem_comp_atom / chem_comp_bond / database_2 / pdbx_initial_refinement_model / pdbx_struct_conn_angle / struct_conn / struct_conn_type / struct_ncs_dom_lim Item: _database_2.pdbx_DOI / _database_2.pdbx_database_accession ..._database_2.pdbx_DOI / _database_2.pdbx_database_accession / _pdbx_struct_conn_angle.ptnr1_auth_comp_id / _pdbx_struct_conn_angle.ptnr1_auth_seq_id / _pdbx_struct_conn_angle.ptnr1_label_alt_id / _pdbx_struct_conn_angle.ptnr1_label_asym_id / _pdbx_struct_conn_angle.ptnr1_label_atom_id / _pdbx_struct_conn_angle.ptnr1_label_comp_id / _pdbx_struct_conn_angle.ptnr3_auth_comp_id / _pdbx_struct_conn_angle.ptnr3_auth_seq_id / _pdbx_struct_conn_angle.ptnr3_label_alt_id / _pdbx_struct_conn_angle.ptnr3_label_asym_id / _pdbx_struct_conn_angle.ptnr3_label_atom_id / _pdbx_struct_conn_angle.ptnr3_label_comp_id / _pdbx_struct_conn_angle.value / _struct_conn.conn_type_id / _struct_conn.id / _struct_conn.pdbx_dist_value / _struct_conn.pdbx_leaving_atom_flag / _struct_conn.pdbx_ptnr2_label_alt_id / _struct_conn.ptnr1_auth_asym_id / _struct_conn.ptnr1_auth_comp_id / _struct_conn.ptnr1_auth_seq_id / _struct_conn.ptnr1_label_asym_id / _struct_conn.ptnr1_label_atom_id / _struct_conn.ptnr1_label_comp_id / _struct_conn.ptnr1_label_seq_id / _struct_conn.ptnr2_auth_asym_id / _struct_conn.ptnr2_auth_comp_id / _struct_conn.ptnr2_auth_seq_id / _struct_conn.ptnr2_label_asym_id / _struct_conn.ptnr2_label_atom_id / _struct_conn.ptnr2_label_comp_id / _struct_conn.ptnr2_label_seq_id / _struct_conn_type.id / _struct_ncs_dom_lim.beg_auth_comp_id / _struct_ncs_dom_lim.beg_label_asym_id / _struct_ncs_dom_lim.beg_label_comp_id / _struct_ncs_dom_lim.beg_label_seq_id / _struct_ncs_dom_lim.end_auth_comp_id / _struct_ncs_dom_lim.end_label_asym_id / _struct_ncs_dom_lim.end_label_comp_id / _struct_ncs_dom_lim.end_label_seq_id

-
Structure visualization

Structure viewer	Molecule: MolmilJmol/JSmol

-
Downloads & links

-
Download

PDBx/mmCIF format	4xwo.cif.gz	2.2 MB	Display	PDBx/mmCIF format
PDB format	pdb4xwo.ent.gz	1.9 MB	Display	PDB format
PDBx/mmJSON format	4xwo.json.gz		Tree view	PDBx/mmJSON format
Others	Other downloads

-
Validation report

Arichive directory	https://data.pdbj.org/pub/pdb/validation_reports/xw/4xwo ftp://data.pdbj.org/pub/pdb/validation_reports/xw/4xwo	HTTPS FTP

-
Related structure data

Related structure data	4xtrC 4xvuC 2wojS 3pgfS C: citing same article (ref.) S: Starting model for refinement
Similar structure data	4xtr-d 3eoa-d 7m3i-d 6urm-d 1iwb-2 4plk-2 Search similar-shape structures by Omokage search (details) Search similar-shape structures by Omokage search (details) Search similar-shape structures by Omokage search (details) Search similar-shape structures by Omokage search (details) Search similar-shape structures by Omokage search (details) Similarity search - Function & homologyF&H Search Similarity search - FunctionF&H Search Similarity search - HomologyF&H Search

Related structure data

C: citing same article (ref.)

S: Starting model for refinement

Similar structure data

-
Links

PDB pages	PDBj / wwPDB / NCBI
Related items in Molecule of the Month	#21 - Sep 2001 Antibodies similarity (1) #256 - Apr 2021 SARS-CoV-2 Spike and Antibodies similarity (1)

-
Assembly

Deposited unit

A: ATPase GET3

B: ATPase GET3

C: Antibody heavy chain

D: Antibody light chain

E: Antibody heavy chain

F: Antibody light chain

G: ATPase GET3

H: ATPase GET3

I: Antibody heavy chain

J: Antibody light chain

K: Antibody heavy chain

L: Antibody light chain

M: ATPase GET3

N: ATPase GET3

O: Antibody heavy chain

P: Antibody light chain

Q: Antibody heavy chain

R: Antibody light chain

S: ATPase GET3

T: ATPase GET3

U: Antibody heavy chain

V: Antibody light chain

W: Antibody heavy chain

X: Antibody light chain

a: Sec22

g: Sec22

m: Sec22

s: Sec22

hetero molecules

723 kDa, 28 polymers
Search similar-shape structures of this assembly by Omokage search (details)

A: ATPase GET3

B: ATPase GET3

C: Antibody heavy chain

D: Antibody light chain

E: Antibody heavy chain

F: Antibody light chain

a: Sec22

hetero molecules

defined by author
181 kDa, 7 polymers
Search similar-shape structures of this assembly by Omokage search (details)

G: ATPase GET3

H: ATPase GET3

I: Antibody heavy chain

J: Antibody light chain

K: Antibody heavy chain

L: Antibody light chain

g: Sec22

hetero molecules

defined by author
181 kDa, 7 polymers
Search similar-shape structures of this assembly by Omokage search (details)

M: ATPase GET3

N: ATPase GET3

O: Antibody heavy chain

P: Antibody light chain

Q: Antibody heavy chain

R: Antibody light chain

m: Sec22

hetero molecules

defined by author
181 kDa, 7 polymers
Search similar-shape structures of this assembly by Omokage search (details)

S: ATPase GET3

T: ATPase GET3

U: Antibody heavy chain

V: Antibody light chain

W: Antibody heavy chain

X: Antibody light chain

s: Sec22

hetero molecules

defined by author
181 kDa, 7 polymers
Search similar-shape structures of this assembly by Omokage search (details)

Unit cell

Length a, b, c (Å)	112.580, 119.450, 147.570
Angle α, β, γ (deg.)	71.890, 89.860, 66.610
Int Tables number	1
Space group name H-M	P1

Noncrystallographic symmetry (NCS)

NCS domain:
NCS domain segments:

Component-ID: 1

Dom-ID	Ens-ID	Beg auth comp-ID	Beg label comp-ID	End auth comp-ID	End label comp-ID	Selection details	Auth asym-ID	Label asym-ID	Auth seq-ID	Label seq-ID
1	1	THR	THR	LEU	LEU	chain A	A	A	4 - 350	4 - 350
2	1	THR	THR	ASP	ASP	chain B	B	B	4 - 352	4 - 352
3	1	THR	THR	LEU	LEU	chain G	G	G	4 - 350	4 - 350
4	1	VAL	VAL	ASP	ASP	chain H	H	H	5 - 352	5 - 352
5	1	THR	THR	LEU	LEU	chain M	M	M	4 - 350	4 - 350
6	1	ASP	ASP	ASP	ASP	chain N	N	N	2 - 352	2 - 352
7	1	THR	THR	LEU	LEU	chain S	S	S	4 - 350	4 - 350
8	1	ASP	ASP	GLU	GLU	chain T	T	T	2 - 351	2 - 351
1	2	GLU	GLU	CYS	CYS	chain C	C	C	4 - 225	4 - 225
2	2	GLU	GLU	CYS	CYS	chain E	E	E	4 - 225	4 - 225
3	2	GLU	GLU	CYS	CYS	chain I	I	I	1 - 225	1 - 225
4	2	VAL	VAL	CYS	CYS	chain K	K	K	5 - 225	5 - 225
5	2	SER	SER	CYS	CYS	chain O	O	O	3 - 225	3 - 225
6	2	VAL	VAL	CYS	CYS	chain Q	Q	Q	5 - 225	5 - 225
7	2	GLU	GLU	CYS	CYS	chain U	U	U	4 - 225	4 - 225
8	2	VAL	VAL	CYS	CYS	chain W	W	W	5 - 225	5 - 225
1	3	ASP	ASP	CYS	CYS	chain D	D	D	2 - 217	2 - 217
2	3	ILE	ILE	CYS	CYS	chain F	F	F	3 - 217	3 - 217
3	3	ILE	ILE	CYS	CYS	chain J	J	J	3 - 217	3 - 217
4	3	ILE	ILE	CYS	CYS	chain L	L	L	3 - 217	3 - 217
5	3	ASP	ASP	CYS	CYS	chain P	P	P	2 - 217	2 - 217
6	3	ASP	ASP	CYS	CYS	chain R	R	R	2 - 217	2 - 217
7	3	ILE	ILE	CYS	CYS	chain V	V	V	3 - 217	3 - 217
8	3	ASP	ASP	CYS	CYS	chain X	X	X	2 - 217	2 - 217
1	4	UNK	UNK	UNK	UNK	chain a	a	Y	1 - 20	1 - 20
2	4	UNK	UNK	UNK	UNK	chain m	m	AA	2 - 20	1 - 19
3	4	UNK	UNK	UNK	UNK	chain s	s	BA	0 - 20	1 - 21

NCS ensembles :

ID
1
2
3
4

-
Components

-
Antibody , 2 types, 16 molecules CEIKOQUWDFJLPRVX

#2: Antibody	Antibody heavy chain / Immunoglobulin heavy chain Mass: 24560.430 Da / Num. of mol.: 8 Source method: isolated from a genetically manipulated source Source: (gene. exp.) HOMO SAPIENS, synthetic construct Description: OBTAINED BY PHAGE DISPLAY FROM A LIBRARY OF HUMAN IGG ANTIBODY FRAGMENT, THE CDRS ARE COMPLETELY SYNTHETIC Plasmid: RH2.2 / Production host: Escherichia coli (E. coli) / Strain (production host): BL21(DE3)/PRIL
#3: Antibody	Antibody light chain / Immunoglobulin light chain Mass: 23671.266 Da / Num. of mol.: 8 Source method: isolated from a genetically manipulated source Source: (gene. exp.) HOMO SAPIENS, synthetic construct Description: OBTAINED BY PHAGE DISPLAY FROM A LIBRARY OF HUMAN IGG ANTIBODY FRAGMENT, THE CDRS ARE COMPLETELY SYNTHETIC Plasmid: RH2.2 / Production host: Escherichia coli (E. coli) / Strain (production host): BL21(DE3)/PRIL

#2: Antibody

Antibody heavy chain /

Immunoglobulin heavy chain

Mass: 24560.430 Da / Num. of mol.: 8
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) HOMO SAPIENS, synthetic construct
Description: OBTAINED BY PHAGE DISPLAY FROM A LIBRARY OF HUMAN IGG ANTIBODY FRAGMENT, THE CDRS ARE COMPLETELY SYNTHETIC
Plasmid: RH2.2 / Production host:

Escherichia coli (E. coli) / Strain (production host): BL21(DE3)/PRIL

#3: Antibody

Antibody light chain /

Immunoglobulin light chain

Mass: 23671.266 Da / Num. of mol.: 8
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) HOMO SAPIENS, synthetic construct
Description: OBTAINED BY PHAGE DISPLAY FROM A LIBRARY OF HUMAN IGG ANTIBODY FRAGMENT, THE CDRS ARE COMPLETELY SYNTHETIC
Plasmid: RH2.2 / Production host:

Escherichia coli (E. coli) / Strain (production host): BL21(DE3)/PRIL

-
Protein / Protein/peptide , 2 types, 12 molecules ABGHMNSTagms

#1: Protein	ATPase GET3 / Arsenical pump-driving ATPase / Arsenite-stimulated ATPase / Golgi to ER traffic protein 3 / Guided ...Arsenical pump-driving ATPase / Arsenite-stimulated ATPase / Golgi to ER traffic protein 3 / Guided entry of tail-anchored proteins 3 Mass: 39392.605 Da / Num. of mol.: 8 / Mutation: D57N Source method: isolated from a genetically manipulated source Source: (gene. exp.) Saccharomyces cerevisiae (ATCC 204508 / S288c) (yeast) Strain: ATCC 204508 / S288c / Gene: GET3, ARR4, YDL100C, D2371 / Plasmid: pCDF1b / Production host: Escherichia coli (E. coli) / Strain (production host): BL21(DE3)/pRIL References: UniProt: Q12154, Hydrolases; Acting on acid anhydrides
#4: Protein/peptide	Sec22 Mass: 3507.314 Da / Num. of mol.: 4 Source method: isolated from a genetically manipulated source Source: (gene. exp.) Saccharomyces cerevisiae (brewer's yeast) Plasmid: pET28 / Production host: Escherichia coli (E. coli) / Strain (production host): BL21(DE3)/pRIL

#1: Protein

ATPase GET3 / Arsenical pump-driving ATPase / Arsenite-stimulated ATPase / Golgi to ER traffic protein 3 / Guided ...

Mass: 39392.605 Da / Num. of mol.: 8 / Mutation: D57N
Source method: isolated from a genetically manipulated source
Source: (gene. exp.)

Saccharomyces cerevisiae (ATCC 204508 / S288c) (yeast)
Strain: ATCC 204508 / S288c / Gene: GET3, ARR4, YDL100C, D2371 / Plasmid: pCDF1b / Production host:

Escherichia coli (E. coli) / Strain (production host): BL21(DE3)/pRIL
References: UniProt: Q12154,

Hydrolases; Acting on acid anhydrides

#4: Protein/peptide

Sec22

Mass: 3507.314 Da / Num. of mol.: 4
Source method: isolated from a genetically manipulated source
Source: (gene. exp.)

Saccharomyces cerevisiae (brewer's yeast)
Plasmid: pET28 / Production host:

Escherichia coli (E. coli) / Strain (production host): BL21(DE3)/pRIL

-
Non-polymers , 5 types, 453 molecules

#5: Chemical	ChemComp-MG / MAGNESIUM ION Mass: 24.305 Da / Num. of mol.: 8 / Source method: obtained synthetically / Formula: Mg
#6: Chemical	ChemComp-ZN / ZINC ION Mass: 65.409 Da / Num. of mol.: 4 / Source method: obtained synthetically / Formula: Zn
#7: Chemical	ChemComp-ADP / ADENOSINE-5'-DIPHOSPHATE / Adenosine diphosphate Mass: 427.201 Da / Num. of mol.: 8 / Source method: obtained synthetically / Formula: C₁₀H₁₅N₅O₁₀P₂ / Comment: ADP, energy-carrying molecule*YM
#8: Chemical	ChemComp-ATP / ADENOSINE-5'-TRIPHOSPHATE / Adenosine triphosphate Mass: 507.181 Da / Num. of mol.: 8 / Source method: isolated from a natural source / Formula: C₁₀H₁₆N₅O₁₃P₃ / Comment: ATP, energy-carrying molecule*YM
#9: Water	ChemComp-HOH / water / Water Mass: 18.015 Da / Num. of mol.: 425 / Source method: isolated from a natural source / Formula: H₂O

-
Details

Sequence details	The sequence of the bound peptide is:MGSHHHHHHSKINFDLLISQYAPIVIVAFFFVFLFWWIFLK However, due to ...The sequence of the bound peptide is:MGSHHHHHHSKINFDLLISQYAPIVIVAFFFVFLFWWIFLK However, due to relatively poor local density, this chain was modeled as a poly-alanine helix

-
Experimental details

-
Experiment

Experiment	Method: X-RAY DIFFRACTION / Number of used crystals: 1

-
Sample preparation

Crystal	Density Matthews: 2.4 Å³/Da / Density % sol: 48.7 %
Crystal grow	Temperature: 298 K / Method: vapor diffusion, hanging drop / Details: 13% PEG 3350, 25 mM succinic acid pH 7.0

-
Data collection

Diffraction	Mean temperature: 100 K
Diffraction source	Source: SYNCHROTRON / Site: APS / Beamline: 24-ID-C / Wavelength: 0.9795 Å
Detector	Type: DECTRIS PILATUS 6M-F / Detector: PIXEL / Date: Mar 10, 2014
Radiation	Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray
Radiation wavelength	Wavelength: 0.9795 Å / Relative weight: 1
Reflection	Resolution: 2.75→39.723 Å / Num. obs: 157053 / % possible obs: 91 % / Redundancy: 1.7 % / Net I/σ(I): 8.2
Reflection shell	Resolution: 2.75→2.85 Å / Redundancy: 1.7 % / Mean I/σ(I) obs: 1.4 / % possible all: 89

-
Processing

Software

Name	Classification
PHENIX	refinement
xia2	data reduction
Coot	model building
PHASER	phasing

Refinement

Method to determine structure:

MOLECULAR REPLACEMENT
Starting model: 2woj, 3pgf

2woj

3pgf

Resolution: 2.75→39.723 Å / SU ML: 0.42 / Cross valid method: FREE R-VALUE / σ(F): 1.97 / Phase error: 28.91 / Stereochemistry target values: ML

	R_factor	Num. reflection	% reflection
R_free	0.2472	7818	5 %
R_work	0.1956	148484	-
obs	0.1983	156302	90.62 %

Solvent computation

Shrinkage radii: 0.9 Å / VDW probe radii: 1.11 Å / Solvent model: FLAT BULK SOLVENT MODEL

Displacement parameters

B_iso max: 278.83 Å² / B_iso mean: 75.163 Å² / B_iso min: 17.19 Å²

Refinement step

Cycle: final / Resolution: 2.75→39.723 Å

	Protein	Nucleic acid	Ligand	Solvent	Total
Num. atoms	45612	0	660	425	46697
B_iso mean	-	-	50.44	51.43	-
Num. residues	-	-	-	-	5938

Refine LS restraints

Refine-ID	Type	Dev ideal	Number
X-RAY DIFFRACTION	f_bond_d	0.005	47135
X-RAY DIFFRACTION	f_angle_d	0.806	63950
X-RAY DIFFRACTION	f_chiral_restr	0.031	7267
X-RAY DIFFRACTION	f_plane_restr	0.004	8057
X-RAY DIFFRACTION	f_dihedral_angle_d	12.307	17009

Refine LS restraints NCS

Ens-ID	Dom-ID	Auth asym-ID	Number	Refine-ID	Rms	Type
1	1	A	11615	X-RAY DIFFRACTION	10.585	TORSIONAL
1	2	B	11615	X-RAY DIFFRACTION	10.585	TORSIONAL
1	3	G	11615	X-RAY DIFFRACTION	10.585	TORSIONAL
1	4	H	11615	X-RAY DIFFRACTION	10.585	TORSIONAL
1	5	M	11615	X-RAY DIFFRACTION	10.585	TORSIONAL
1	6	N	11615	X-RAY DIFFRACTION	10.585	TORSIONAL
1	7	S	11615	X-RAY DIFFRACTION	10.585	TORSIONAL
1	8	T	11615	X-RAY DIFFRACTION	10.585	TORSIONAL
2	1	C	7964	X-RAY DIFFRACTION	10.585	TORSIONAL
2	2	E	7964	X-RAY DIFFRACTION	10.585	TORSIONAL
2	3	I	7964	X-RAY DIFFRACTION	10.585	TORSIONAL
2	4	K	7964	X-RAY DIFFRACTION	10.585	TORSIONAL
2	5	O	7964	X-RAY DIFFRACTION	10.585	TORSIONAL
2	6	Q	7964	X-RAY DIFFRACTION	10.585	TORSIONAL
2	7	U	7964	X-RAY DIFFRACTION	10.585	TORSIONAL
2	8	W	7964	X-RAY DIFFRACTION	10.585	TORSIONAL
3	1	D	8179	X-RAY DIFFRACTION	10.585	TORSIONAL
3	2	F	8179	X-RAY DIFFRACTION	10.585	TORSIONAL
3	3	J	8179	X-RAY DIFFRACTION	10.585	TORSIONAL
3	4	L	8179	X-RAY DIFFRACTION	10.585	TORSIONAL
3	5	P	8179	X-RAY DIFFRACTION	10.585	TORSIONAL
3	6	R	8179	X-RAY DIFFRACTION	10.585	TORSIONAL
3	7	V	8179	X-RAY DIFFRACTION	10.585	TORSIONAL
3	8	X	8179	X-RAY DIFFRACTION	10.585	TORSIONAL
4	1	a	162	X-RAY DIFFRACTION	10.585	TORSIONAL
4	2	m	162	X-RAY DIFFRACTION	10.585	TORSIONAL
4	3	s	162	X-RAY DIFFRACTION	10.585	TORSIONAL

LS refinement shell

Refine-ID: X-RAY DIFFRACTION / Total num. of bins used: 30

Resolution (Å)	R_factor R_free	Num. reflection R_free	R_factor R_work	Num. reflection R_work	Num. reflection all	% reflection obs (%)
2.75-2.7819	0.374	248	0.299	4488	4736	82
2.7819-2.8146	0.3701	252	0.2982	5042	5294	93
2.8146-2.8489	0.3327	262	0.294	5107	5369	93
2.8489-2.885	0.3687	239	0.2857	5072	5311	93
2.885-2.9229	0.3444	276	0.2806	5052	5328	93
2.9229-2.963	0.3345	247	0.2764	5109	5356	93
2.963-3.0053	0.3124	261	0.2811	5053	5314	93
3.0053-3.0501	0.3501	242	0.2848	5138	5380	93
3.0501-3.0978	0.3429	271	0.2698	4961	5232	92
3.0978-3.1485	0.346	267	0.2637	4943	5210	91
3.1485-3.2028	0.3203	261	0.2544	4795	5056	88
3.2028-3.261	0.3098	240	0.2476	4995	5235	92
3.261-3.3237	0.2817	265	0.2332	5129	5394	93
3.3237-3.3915	0.2964	291	0.2324	5047	5338	93
3.3915-3.4652	0.27	267	0.2239	5051	5318	93
3.4652-3.5458	0.2648	265	0.2201	5131	5396	93
3.5458-3.6344	0.2604	268	0.2089	5024	5292	92
3.6344-3.7326	0.2852	280	0.2021	4971	5251	91
3.7326-3.8423	0.2642	237	0.1929	4895	5132	90
3.8423-3.9662	0.2274	264	0.1806	4704	4968	86
3.9662-4.1079	0.2211	294	0.1723	5058	5352	93
4.1079-4.2721	0.218	250	0.1581	5064	5314	92
4.2721-4.4663	0.2029	285	0.1433	4957	5242	91
4.4663-4.7015	0.1932	267	0.1435	4934	5201	90
4.7015-4.9955	0.187	233	0.139	4905	5138	89
4.9955-5.3803	0.195	288	0.1483	4729	5017	87
5.3803-5.9202	0.2244	266	0.164	4949	5215	91
5.9202-6.7732	0.2446	238	0.174	4878	5116	89
6.7732-8.5196	0.1917	241	0.1678	4718	4959	86
8.5196-39.7266	0.1853	253	0.1702	4585	4838	84

Refinement TLS params.

Method: refined / Refine-ID: X-RAY DIFFRACTION

ID	L11 (°²)	L12 (°²)	L13 (°²)	L22 (°²)	L23 (°²)	L33 (°²)	S11 (Å °)	S12 (Å °)	S13 (Å °)	S21 (Å °)	S22 (Å °)	S23 (Å °)	S31 (Å °)	S32 (Å °)	S33 (Å °)	T11 (Å²)	T12 (Å²)	T13 (Å²)	T22 (Å²)	T23 (Å²)	T33 (Å²)	Origin x (Å)	Origin y (Å)	Origin z (Å)
1	3.1122	1.2255	1.0461	3.1969	-0.7582	3.5489	0.1851	-1.0564	0.5802	0.5381	-0.4739	-0.4773	-0.0875	0.4497	0.2673	0.4562	-0.1786	-0.1056	0.7927	-0.0796	0.4104	100.5667	-241.9558	-122.0167
2	8.3086	-0.1512	-2.5238	6.06	-0.7399	0.9253	0.8077	-0.3401	-0.2085	0.463	-0.4777	-1.0504	0.0566	0.8899	-0.123	0.8843	-0.1644	-0.1004	0.9483	0.042	0.772	110.1883	-266.0229	-127.1196
3	2.5583	-0.3343	-1.9253	7.9525	2.3921	2.3142	0.0767	-1.1793	-0.3123	0.9608	-0.1479	-0.1536	0.661	0.191	0.0538	0.5939	-0.09	-0.0407	0.8781	0.0626	0.366	99.097	-254.6398	-119.0569
4	1.7825	-0.8793	-0.0222	6.0921	-0.7857	3.5663	-0.4811	-1.0175	-0.7376	1.9986	0.5892	0.9039	1.3722	0.0548	0.0241	1.4135	-0.0385	0.0683	1.1695	0.1658	0.4406	94.6999	-265.2093	-110.6634
5	6.6745	1.6342	1.7775	4.5573	-2.2334	4.9247	0.0512	-0.3262	0.5691	0.2931	0.011	0.4943	-0.1866	-0.0976	-0.0954	0.2607	-0.0068	0.0665	0.4338	-0.139	0.4268	83.6089	-242.8657	-126.7857
6	4.9925	-0.959	-0.2541	0.4645	-0.3494	1.5746	0.2263	-0.2331	1.4955	0.098	-0.0841	0.0996	-0.7298	0.2017	-0.1422	0.5627	-0.0956	0.0692	0.392	-0.077	0.8758	86.8279	-231.586	-131.6973
7	5.5525	0.0858	-0.3104	3.3301	0.6001	3.6803	-0.1255	-0.0174	-0.3136	0.0941	-0.197	0.2406	0.49	-0.3108	0.2965	0.3436	-0.0421	0.0069	0.3406	-0.0739	0.2908	82.9859	-260.997	-147.2406
8	7.6654	-0.45	3.2505	3.7543	-1.2229	8.0954	-0.0405	-0.1211	-0.9998	0.416	0.2334	0.2893	1.1866	0.6202	0.0938	0.6203	0.0444	0.0054	0.3464	0.0204	0.5199	89.3389	-268.5661	-137.9372
9	3.9336	0.1041	-0.6327	0.9672	1.1385	2.4864	-0.1535	-0.1668	-0.3885	0.1463	0.1585	-0.2075	0.5479	0.2965	-0.0939	0.3868	0.0628	-0.0147	0.4793	0.0531	0.3774	99.2129	-261.9204	-144.8447
10	5.682	2.8825	-1.4234	3.1724	-0.2364	1.431	0.1977	0.602	0.9159	-0.2266	0.0063	0.2811	-0.4909	-0.1461	-0.1709	0.4814	0.0552	0.0467	0.4978	0.179	0.4467	88.5933	-241.566	-153.3145
11	8.15	2.5792	-2.7878	1.8403	-0.612	2.8366	-0.0699	-0.2694	-0.5527	0.0944	-0.1173	0.1806	0.2291	0.1633	0.2412	0.3581	0.0905	0.062	0.2789	0.0014	0.3897	56.2006	-257.9327	-127.142
12	4.1137	0.1042	0.5712	6.1144	-0.615	3.9394	-0.1312	-0.4519	-0.1722	-0.0662	-0.0047	0.2544	0.3177	-0.927	0.2072	0.4096	-0.0579	0.064	0.5535	0.006	0.3035	19.9083	-256.376	-117.6819
13	7.0096	-2.2288	-0.4544	7.5459	-1.212	4.9597	-0.2706	-1.5493	0.1016	1.1118	0.3358	1.1473	-0.3815	0.0361	0.131	0.4149	-0.1379	0.1248	0.5987	-0.3059	0.635	50.2631	-238.1526	-110.5739
14	7.4977	-1.6509	-1.4222	2.9618	0.4378	5.8665	0.3602	-0.5341	1.1039	0.0733	-0.1499	-0.0623	-0.449	0.2164	-0.1306	0.4109	-0.0898	0.1236	0.3866	-0.1286	0.5301	54.8329	-237.1953	-118.6567
15	9.6015	-2.085	-4.1295	1.2329	0.3539	3.1346	-0.0892	-0.7667	0.4939	0.523	0.1682	-0.2722	0.1601	0.2061	-0.1541	0.4439	-0.0702	0.0204	0.6056	-0.246	0.4817	50.4199	-242.4623	-113.4473
16	2.5757	-1.2033	-0.9604	3.69	-1.0114	2.9444	-0.0863	0.0063	0.0108	0.2264	0.1448	-0.0566	0.1397	-0.0239	0.0073	0.3688	-0.0633	0.0046	0.435	0.0181	0.3391	24.175	-253.6101	-104.8544
17	2.8798	0.5025	-3.0189	2.1935	-3.5698	9.5755	-0.3179	-0.8409	-0.1673	0.3151	-0.4945	-0.3909	0.3563	1.6689	0.5452	0.3883	0.0494	-0.0207	0.948	0.1175	0.5463	30.4629	-257.1557	-99.3454
18	3.5996	0.98	-1.0705	5.8103	1.9753	2.9375	0.2458	-0.6042	-0.1262	0.4045	-0.4276	0.0087	0.0795	0.0225	0.1463	0.3158	0.0343	0.0191	0.5515	-0.0255	0.3325	25.9756	-253.178	-104.4479
19	8.5131	6.4596	-6.115	5.7064	-6.1879	8.2618	-0.3955	0.5574	-0.1432	0.6138	0.8401	0.4352	-0.6291	-0.5823	-0.3703	0.5876	0.0313	0.0415	0.7554	0.0079	0.5595	19.1373	-250.0611	-97.2954
20	2.7037	0.1234	-0.3537	1.3057	1.0261	1.4593	0.0733	-1.5155	0.6266	0.0773	0.1654	-0.4934	0.0924	0.4036	0.0628	0.427	0.0277	0.0861	0.5147	0.1939	0.3566	133.8944	-241.8167	-139.2845
21	3.2571	-0.4125	-0.0709	2.2216	-0.2376	1.3864	-0.2179	-0.3105	-0.2379	0.0922	0.0437	0.087	0.1665	-0.0056	-0.0074	0.3773	-0.0115	0.0007	0.4621	0.1966	0.4024	124.9082	-244.4212	-143.9109
22	2.1202	-1.0863	0.6997	4.5034	0.0033	2.7685	-0.0347	-0.5817	-0.4673	-0.183	-0.5295	0.9935	0.3795	-0.4058	0.049	0.5125	0.0135	0.0963	0.2848	0.5849	0.3638	122.9113	-253.0463	-140.5379
23	4.9647	-0.5196	-0.4752	0.8942	-0.9256	1.2456	-0.0975	-0.4209	-0.0761	0.2217	0.0558	0.1167	0.0451	0.2276	0.0168	0.4394	-0.021	-0.0103	0.4151	0.1628	0.3674	130.5282	-244.5545	-143.266
24	7.6558	-2.2078	4.5925	2.7149	-1.3342	2.7384	0.258	1.7855	0.4496	0.253	-0.0579	0.4913	-0.2461	0.4344	-0.2156	0.525	-0.0945	-0.0429	0.6465	0.0203	0.5292	167.372	-236.5421	-163.6304
25	1.3526	0.6476	0.43	2.1428	-2.1945	4.1832	0.4389	-0.1234	0.6015	0.1091	-0.1329	0.3279	-0.7741	-0.1471	-0.3599	0.4743	0.0878	0.0289	0.2492	0.1255	0.6042	157.3638	-235.7513	-151.7566
26	4.2148	-0.1388	0.1374	1.1366	1.4146	3.9697	0.0314	0.1898	0.5072	0.4085	0.1444	-0.5176	-0.9211	0.0589	-0.1848	0.3859	-0.0165	-0.0387	0.2442	0.1192	0.5536	159.072	-234.6462	-158.5072
27	9.3911	5.5201	1.8754	7.0926	-3.5581	6.0653	0.2981	-1.046	1.1006	0.7292	-0.1336	-0.1815	-1.1603	0.9766	0.0658	0.5076	0.0056	-0.0642	0.4068	-0.0283	0.4654	163.6147	-232.7315	-149.5101
28	3.4167	2.9822	-2.9829	4.4723	-5.8141	8.1572	0.1175	1.1905	-0.6352	-0.3615	-0.6405	-0.9903	-0.0274	-0.1699	0.6441	0.4137	0.1271	0.0283	0.5539	0.114	0.4463	129.6721	-244.815	-169.7883
29	4.0101	0.5185	-0.2714	0.5966	-0.6546	5.5475	0.0193	0.1182	0.1313	0.0701	-0.1162	-0.1232	-0.1236	0.1684	0.0889	0.2723	0.0643	-0.0014	0.3543	0.1559	0.3973	122.8949	-241.0925	-163.982
30	6.671	1.9222	-3.6686	0.3871	-0.6666	6.4009	-0.3763	0.7345	-0.6803	-0.3072	0.0782	-0.1807	0.7917	-0.5615	0.2494	0.3809	0.1844	0.0304	0.3929	0.2547	0.5214	130.4518	-245.7027	-163.5814
31	6.5669	-1.0189	0.7377	3.055	-2.1092	4.5277	-0.2149	0.1325	-0.2061	-0.1854	0.3193	0.0033	0.192	-0.2177	-0.0949	0.3848	-0.0442	-0.0278	0.219	0.057	0.4128	158.8759	-245.8188	-163.2837
32	2.5052	-3.5472	3.507	5.9838	-4.2043	8.4916	0.1188	0.0726	0.0488	-0.2824	-0.3655	-0.9703	0.3911	0.0591	0.5801	0.4134	-0.0162	0.1358	0.5381	0.0476	0.6843	166.1603	-248.9782	-169.7179
33	3.2917	-0.0604	-0.0324	5.2208	-2.1223	5.2577	-0.2501	-0.6085	0.7145	0.5582	-0.3349	0.2667	-0.2788	-0.2475	0.3652	0.2548	-0.0715	-0.0154	0.4164	-0.2107	0.459	57.5965	-161.1964	-47.3507
34	6.5481	1.346	0.2045	4.7085	0.3604	3.4683	-0.1205	-0.3248	0.1634	-0.0558	0.0784	-0.3814	0.496	0.5118	0.0354	0.3773	0.0391	-0.0502	0.4619	0.0145	0.3259	72.9145	-165.8131	-53.4227
35	7.5924	1.5654	1.8424	7.1536	3.3293	6.9916	-0.0573	-0.4254	-0.7624	0.6664	-0.0643	-0.3043	1.1001	0.5375	0.1568	0.541	0.0655	-0.0411	0.5116	0.064	0.3856	67.7872	-177.6437	-51.6398
36	5.9253	-0.2109	0.6212	1.7946	-0.4434	3.4509	0.0353	-0.9169	-0.6616	0.208	-0.1023	0.1283	1.0639	0.1212	-0.1475	0.6471	0.0408	0.0759	0.4551	0.0927	0.2804	56.0496	-177.684	-48.2855
37	5.7362	3.8395	-2.7836	6.5167	-0.9078	2.4753	0.1993	-0.1092	1.3586	-0.1485	0.5971	1.3326	-0.6125	-0.1439	-0.5589	0.4138	0.0305	-0.0508	0.3715	-0.013	0.706	51.0156	-153.6676	-60.3103
38	5.4295	-0.4197	1.1892	2.4319	-0.1628	2.2335	0.2148	0.0262	1.2532	-0.0175	-0.0542	0.1012	-0.6333	0.0611	-0.1344	0.4009	0.0261	0.0298	0.2764	-0.0397	0.6296	53.6342	-151.4995	-60.0378
39	4.591	0.2654	0.6527	3.8917	-0.1178	1.7803	0.0096	0.6504	-0.4534	-0.0253	-0.0398	0.1477	0.3975	-0.3188	0.162	0.3348	-0.02	-0.0048	0.5293	-0.145	0.2615	50.1529	-179.4167	-78.0306
40	2.3249	0.5975	0.5988	2.6276	0.2195	4.7596	-0.0954	0.1658	-1.2098	-0.2263	-0.2606	0.7674	0.5805	-1.0162	0.8103	0.6531	0.093	-0.0041	0.5995	-0.1419	0.886	55.0424	-191.3388	-66.5692
41	5.0443	0.1761	0.0479	5.0963	0.4651	3.4439	-0.3061	0.2559	-1.3305	-0.0228	-0.1078	-0.8693	1.2997	0.3241	0.2184	0.7938	0.0885	0.2061	0.5628	-0.1025	0.6598	64.5382	-192.6983	-72.5731
42	3.9919	1.6081	-1.1246	3.4726	1.0931	1.9673	-0.0386	0.9882	0.7917	-0.4201	0.1552	-0.2083	-0.2459	0.0252	-0.033	0.4052	-0.0293	-0.0195	0.7003	0.2205	0.3092	59.8255	-162.7257	-80.7088
43	5.7591	-0.3492	-1.7118	8.2958	-4.0158	8.0078	-0.4896	0.8714	-0.6721	-0.9027	0.1916	-0.1851	0.5025	-0.1501	0.2924	0.298	-0.0439	-0.0501	0.3604	-0.188	0.3226	20.0089	-177.7924	-64.6704
44	5.5709	1.0875	-1.2139	3.2503	-0.3126	1.5028	-0.1771	0.1413	-0.5959	-0.1174	-0.0135	0.0352	0.1722	0.1753	0.1889	0.2857	0.0586	0.0113	0.1756	-0.0407	0.2585	24.1958	-177.9529	-57.609
45	7.2042	-1.1019	0.2796	6.0496	-0.0009	4.0093	-0.2863	-0.0247	-0.5568	-0.0966	0.279	0.2012	0.2703	-1.0123	0.0352	0.3121	-0.0464	-0.0056	0.4196	0.0677	0.3649	-12.7802	-178.3043	-49.1374
46	6.5432	-5.1008	-1.0863	8.4262	-1.5107	5.4454	0.1895	-1.1351	0.5125	0.9141	-0.1364	0.5672	-0.7213	0.7647	0.1843	0.36	0.0212	-0.0103	0.1884	-0.1287	0.6566	16.5377	-160.1146	-39.5078
47	3.7523	0.2119	-1.932	3.3789	0.2223	3.3203	-0.0474	-0.1262	0.9083	-0.0043	0.0342	0.2103	-0.4284	0.2522	-0.0401	0.3888	-0.0169	-0.0469	0.1393	-0.0911	0.4476	21.9413	-159.0571	-47.3608
48	9.1764	2.2633	-1.423	6.9801	-1.8448	2.898	-0.0208	-1.3367	-0.62	0.9356	0.0433	-0.8465	0.1366	0.5705	-0.0806	0.3301	0.0202	-0.0458	0.4862	-0.058	0.3756	30.9163	-170.3654	-46.5802
49	6.4125	-1.601	-1.487	0.4659	0.2156	0.4545	-0.3794	-1.0032	0.689	0.4171	0.3822	-0.2691	0.0182	0.3147	-0.0472	0.4739	0.1389	-0.0633	0.2698	-0.025	0.5668	2.3129	-159.1912	-38.4081
50	4.7601	1.7278	-0.7111	8.476	-2.457	4.752	-0.2681	-0.4958	-0.6191	-0.231	0.2861	-0.0239	0.19	-0.7829	0.0032	0.2529	0.0739	0.0103	0.4773	0.052	0.3837	-8.2269	-178.0806	-36.1146
51	0.7618	1.5622	0.4192	5.4807	-3.2586	6.6429	0.428	-0.7406	0.1869	0.209	0.1529	0.4758	0.1619	0.1756	-0.4442	0.331	0.1172	0.0092	0.6205	0.1067	0.5402	-1.5627	-182.4415	-31.7232
52	4.7702	2.0007	-0.1404	6.5544	-1.5973	3.0521	0.0067	-0.4666	-0.2563	-0.0647	0.164	0.3492	0.1921	-0.4605	-0.1638	0.206	0.0939	0.0247	0.4266	0.0292	0.3354	-6.3347	-177.5653	-35.5753
53	6.6877	3.5494	-1.4731	3.1635	-2.6792	5.0802	0.2006	-0.5611	0.0682	0.7975	0.1089	1.76	-0.2851	-1.1729	-0.0689	0.4122	0.2	0.0138	0.9889	0.1524	0.7676	-12.4447	-176.0174	-27.572
54	7.3366	-1.2487	-1.8601	2.0817	0.7193	1.1573	-0.2858	-0.3361	-0.1668	0.1219	0.0908	0.1289	0.1532	0.3251	0.1521	0.3626	0.0221	0.0083	0.6007	0.1852	0.3468	93.4527	-165.0074	-71.0821
55	4.8287	-0.7474	-1.0451	0.8395	-0.9347	2.6481	-0.1954	-0.9395	-0.2064	0.0553	0.203	0.0625	0.2171	0.2682	-0.0087	0.3625	0.0087	-0.0105	0.6911	0.1777	0.4124	97.6938	-162.6812	-72.3051
56	6.0868	-3.0122	2.3816	5.1893	-0.7941	0.9705	-0.6306	0.8843	0.4196	-0.3768	0.2217	-0.9195	0.1168	-0.8701	0.0576	0.3732	-0.1007	-0.0011	0.7981	0.1576	0.6904	131.5211	-155.5917	-86.5949
57	4.0766	2.0199	-0.0597	2.569	-1.7576	7.5202	-0.4997	-1.0425	0.8705	-0.2734	0.2682	0.0376	-1.5828	-0.6766	-0.6232	0.4618	0.2196	0.1802	0.6193	-0.0661	0.7495	122.2959	-150.7017	-78.471
58	4.689	1.3907	1.9484	2.5708	-1.337	6.6602	-0.1915	-0.1556	0.8834	0.1543	0.472	-0.3828	-0.46	-0.7064	-0.4736	0.3376	0.0832	0.0887	0.5888	0.1002	0.6803	121.2649	-156.0113	-84.5413
59	3.1577	-1.236	-0.3347	1.4495	0.8267	8.3726	-0.3041	0.1668	2.2415	-0.1136	0.2102	-0.463	-1.6608	0.8643	0.2366	0.6746	-0.0728	-0.1228	0.777	0.4154	1.3682	130.8049	-148.1675	-89.6878
60	6.9661	5.6546	-4.5616	5.1461	-3.7717	3.6983	0.4933	0.0483	0.6152	0.4184	0.5252	-0.1361	-0.168	0.7462	-1.2246	0.8266	0.0376	0.0131	1.1499	-0.0301	1.0018	131.0885	-150.6538	-78.2841
61	4.4682	2.5507	-0.5859	7.7333	-2.8207	5.6305	-0.9316	1.3368	0.0371	-0.6015	1.0073	-0.3455	-0.0593	-0.2453	-0.1542	0.4201	-0.0274	0.0191	0.9408	0.1362	0.6128	96.8223	-160.7106	-98.5579
62	5.7033	0.962	-1.1169	0.6452	-0.9379	3.6603	-0.1945	1.1544	0.6794	-0.0594	-0.0236	0.0374	0.144	0.0835	0.211	0.3959	-0.0078	-0.0289	0.7376	0.2239	0.4143	89.0758	-157.9951	-90.4183
63	3.1829	-1.3674	-0.7302	0.8613	0.2759	2.7058	-0.2075	1.3883	0.6088	-0.1718	-0.0653	-0.0466	-0.0139	-0.0456	0.244	0.3795	-0.089	-0.0738	1.2128	0.3762	0.5193	91.4035	-156.8805	-95.4137
64	6.0625	1.0792	-0.2971	8.5416	-1.5313	5.3671	-0.2812	0.861	-1.6428	-0.8408	0.2274	0.3828	0.7293	-0.213	0.0642	0.5157	-0.0806	-0.055	0.9433	0.0435	0.4055	87.2668	-169.4934	-84.8398
65	0.0026	-0.0276	-0.0122	0.7415	0.3018	0.0892	-0.7973	1.0305	0.3677	-0.6546	0.0386	-0.5194	-0.0312	0.4138	0.5867	0.5525	-0.0962	0.0672	1.741	0.4863	0.663	109.5118	-153.9113	-101.6662
66	4.1788	-0.6102	-2.9903	6.1799	-0.4701	2.7359	-0.2903	-0.0283	-0.1406	-0.6733	0.3525	-0.2187	-0.0458	-0.2395	-0.0713	0.4137	-0.0689	0.0691	0.7508	0.0333	0.4476	127.7192	-162.1369	-92.9022
67	5.7715	-0.8343	-1.0326	1.81	0.5082	0.3571	0.3668	1.134	0.5509	-1.1479	0.143	-1.3304	0.0868	-0.6048	-0.4442	0.71	-0.1885	0.2364	0.8896	-0.035	0.6069	125.5218	-171.0497	-92.845
68	5.045	-1.7385	0.554	2.9248	-1.4504	2.0394	-0.3522	0.0432	0.2379	0.2989	0.351	0.1505	-0.1424	0.2377	0.0744	0.5149	-0.0236	0.1694	0.9596	0.0431	0.5315	122.6571	-159.5772	-91.5244
69	7.978	-4.6652	3.6373	7.0648	-4.01	2.853	-0.2786	0.3737	0.0542	-0.3559	-0.2845	-0.8396	-0.0965	0.3292	0.6685	0.5646	-0.0459	0.141	1.2753	0.0294	0.7037	132.7389	-166.0349	-99.214
70	1.8134	-0.4456	0.7671	5.4638	-1.0186	3.1048	-0.005	-0.1016	0.4456	0.2569	-0.1346	-0.2635	-0.2592	0.4924	0.122	0.4187	-0.1083	-0.0107	0.3287	-0.0797	0.3829	93.3915	-166.2746	-156.7269
71	6.0977	-1.8405	0.8411	3.3728	-1.0305	3.1255	0.0625	-0.9087	-0.0176	1.2122	0.0439	-0.2485	0.2435	0.5902	-0.1241	0.8208	-0.0061	-0.0937	0.5874	-0.0974	0.4139	93.0181	-176.4565	-143.1601
72	3.0088	0.4298	0.9972	1.2513	-0.0128	3.5909	0.0261	0.2177	0.2709	-0.0529	0.0279	0.3785	0.0076	-0.3198	0.0161	0.3742	0.0574	0.0264	0.2799	-0.0689	0.5628	76.3491	-168.1831	-168.2592
73	3.8929	0.0425	0.0857	2.958	0.5045	3.0334	0.0219	0.2655	-0.2998	-0.2273	-0.0086	0.1812	0.2242	-0.2147	0.0622	0.4024	0.0481	-0.1036	0.2396	-0.102	0.3686	89.1745	-194.7219	-176.8396
74	4.8613	1.5397	2.0116	4.5153	2.8746	3.2608	-0.0769	-1.4007	-0.1317	1.2493	-0.8777	1.2558	0.9279	-1.3267	0.0686	0.6613	-0.0349	0.0119	0.4966	-0.0898	0.5516	86.3611	-196.0766	-156.909
75	2.9733	-0.0536	-0.8796	3.4895	-0.4953	3.6838	-0.0895	-0.3984	-0.284	0.3257	0.0191	-0.2045	0.3768	0.4988	0.1081	0.4536	0.0664	-0.0537	0.3678	-0.113	0.3771	101.7218	-193.7471	-164.7637
76	9.9803	-4.8851	0.4414	7.7189	-2.6546	1.9836	0.449	2.3754	-0.0172	-0.2317	-0.8218	0.3565	0.7835	0.0011	-0.4002	0.7877	0.0844	-0.0648	0.3108	-0.1625	0.2709	91.383	-177.7403	-184.3694
77	2.3443	0.3691	0.2414	4.8317	-0.9319	0.4808	0.0977	0.8305	0.0011	-0.5708	0.1049	0.5201	-0.1019	0.0137	-0.1578	0.4265	0.0587	-0.105	0.5253	-0.0472	0.3247	87.2327	-179.3806	-186.6382
78	5.4286	0.0652	1.3646	3.3164	-2.7105	4.1618	0.7152	0.9216	-1.0412	-0.7365	-0.3712	0.0971	1.2977	0.2377	0.2453	0.6123	-0.1166	-0.1466	0.1358	-0.2053	0.7407	54.7505	-203.7764	-162.2409
79	2.6402	0.3485	-1.2089	4.0437	-1.4285	4.3419	0.0716	-0.1477	-0.3207	0.1967	0.0219	0.2292	0.3281	0.2601	-0.0869	0.4317	-0.0518	-0.0418	0.1999	-0.1071	0.4258	61.2003	-195.2318	-158.3782
80	4.3987	1.9731	-1.0215	1.6865	-0.2152	2.006	0.0791	-0.294	0.0195	0.2305	0.0051	0.0403	0.1548	0.1392	-0.1423	0.5156	-0.0158	-0.0434	0.2296	-0.078	0.4807	55.2764	-198.9489	-159.0368
81	2.7484	3.378	-0.3552	4.299	-1.3541	5.9103	0.0422	-0.0168	0.2973	1.3166	-0.262	1.403	0.6822	-1.9646	-0.0777	0.5566	-0.2102	0.1473	0.9208	-0.2307	0.7421	21.2893	-210.2116	-154.1254
82	4.4365	1.8183	0.2499	5.1265	-0.8662	4.969	0.4719	0.6904	-0.035	-0.1235	-0.4871	0.3225	0.8992	-0.2175	0.1354	0.4442	0.1036	-0.0349	0.5883	-0.0469	0.4061	30.8597	-210.511	-161.8113
83	4.6943	2.0103	0.9159	7.0939	-1.4173	4.8928	0.1342	0.2434	-0.0516	0.9673	-0.2359	1.6421	-0.0796	-1.3936	-0.4064	0.4523	-0.0993	0.0899	1.02	-0.1691	0.7412	25.4044	-205.4555	-156.7496
84	9.1767	-0.5784	-1.7067	9.3627	-0.594	7.0241	0.3845	1.9137	0.3361	0.2749	-0.4546	0.9436	-0.0306	-0.3477	0.0563	0.7566	-0.1042	0.0122	0.5781	-0.0815	0.5524	23.1889	-213.8415	-163.2152
85	7.0367	0.1677	0.6243	9.387	-0.3405	5.4755	-0.1304	0.5896	-0.4263	1.041	0.0047	2.0026	-0.159	-1.3481	0.3543	0.9606	-0.1393	0.0948	0.6916	-0.1697	1.0347	19.6867	-217.5483	-158.4377
86	5.1509	0.5495	1.0232	6.1901	0.2951	6.7109	0.7909	-0.4469	1.0632	0.3139	-0.6632	0.9832	0.0202	-0.0439	-0.0457	0.5453	0.0027	0.2191	0.5914	-0.0472	0.8755	40.9655	-178.3355	-153.1909
87	5.3094	-0.797	-2.242	4.3092	0.3932	2.7702	0.282	-0.0805	0.8065	0.1957	-0.048	0.6269	-0.4145	-0.0345	-0.2207	0.4701	0.0016	0.0863	0.2737	-0.067	0.8063	48.6511	-179.0636	-159.2158
88	0.0529	-0.0061	0.1694	-0.0146	-0.0317	0.4319	-0.2578	0.6305	0.6372	0.0391	-0.1301	1.9674	0.1221	-1.1241	0.104	0.3751	-0.0279	0.2059	1.0605	-0.2426	1.683	25.9752	-184.1229	-156.2756
89	4.4913	0.2432	0.0743	4.1693	-0.0455	2.9656	0.1322	-0.6662	0.6765	1.8118	-0.5107	1.5101	0.4302	-0.9138	0.2953	0.9583	-0.2299	0.4453	0.9267	-0.2719	0.9761	20.8387	-203.304	-146.897
90	2.1774	-0.672	-0.2763	2.4464	-3.1963	5.0204	0.0174	-1.0047	0.6933	1.8815	0.1686	0.7381	0.5304	-0.867	-0.4824	1.5569	-0.3608	0.458	1.4653	-0.3494	0.8924	25.1844	-202.1657	-138.413
91	2.3999	-2.3712	0.6223	2.8781	-1.2038	0.7945	0.782	1.7343	1.1741	0.0724	-1.6106	0.4105	-0.0145	-0.7082	0.5925	0.6515	0.0279	0.0115	1.1617	-0.0008	0.8935	25.6376	-191.4963	-160.024
92	4.3645	-0.2958	0.0157	1.0881	2.0897	4.1215	0.8002	-1.0573	-0.2611	2.482	-0.4389	1.963	0.5623	-0.2399	-0.6692	1.4969	-0.3279	0.4108	1.118	-0.0374	0.8764	22.9613	-211.2623	-139.732
93	3.7593	-1.2863	0.5537	5.8298	-4.5958	5.2138	-0.2073	-1.1975	-0.0324	0.1707	0.9445	0.3807	-0.6282	-0.9488	-0.6972	1.2995	-0.2029	0.744	1.3811	-0.2536	1.4921	14.2572	-200.6466	-141.1522
94	7.3256	0.4473	0.7803	3.9001	-0.1987	4.8166	0.0766	-0.8278	0.7652	0.3863	-0.1368	0.1157	-0.2017	-0.4266	0.0131	0.477	-0.0225	0.0619	0.432	-0.1509	0.3114	120.8714	-162.4846	-170.9418
95	6.9865	1.8347	-0.7682	4.6197	-0.6053	6.5057	0.0435	-0.2508	-0.8409	-0.1879	-0.0036	-0.0104	0.5946	-0.2552	-0.064	0.4646	0.0164	-0.0897	0.3189	0.0315	0.3373	121.5437	-172.4136	-171.6676
96	6.9782	0.7458	0.6112	1.1697	-0.0427	0.3724	-0.023	-0.4891	0.1166	-0.0567	0.1496	-0.1564	-0.0971	0.0341	-0.1052	0.4746	0.0333	0.0465	0.4486	-0.1213	0.3487	128.0664	-163.8205	-173.1782
97	8.9772	-1.303	4.5104	4.2524	0.7096	3.289	0.1786	3.8542	1.1078	-1.5384	-0.0576	-0.9789	-0.0261	0.9211	-0.4654	1.1434	0.0644	0.5212	1.3595	0.0455	1.3659	164.8707	-153.1827	-196.3216
98	2.4086	0.2151	0.1764	4.5426	0.7171	5.9787	0.029	0.0151	0.6287	0.4576	0.3017	0.4441	-0.7693	-0.6295	-0.2218	0.4807	0.1009	0.1818	0.3832	-0.0426	0.738	150.5108	-154.4835	-180.9113
99	2.8444	1.432	1.2277	6.2809	2.1874	3.7273	0.1014	0.241	1.1881	-0.2619	0.3251	-0.8652	-1.3833	0.7307	-0.293	0.8697	0.08	0.1217	0.5229	-0.0038	1.1955	157.977	-148.7562	-188.8296
100	2.8759	1.664	1.2826	3.8245	-3.6967	7.2955	-0.1462	-0.3455	0.8879	0.6159	0.494	-1.0938	-1.8866	0.1258	-0.483	1.0185	-0.1157	0.2334	0.5311	-0.2398	1.1539	156.7865	-148.1193	-177.2738
101	7.6746	0.0228	0.5192	2.751	-3.7349	8.9902	-0.2401	1.6755	-1.1064	0.0907	-0.6271	-0.5252	0.4366	0.7751	0.3302	0.7247	-0.1232	0.1424	0.8387	-0.3028	0.5012	128.8023	-172.338	-196.6061
102	7.1845	1.226	-1.0634	1.6576	-0.4334	3.5537	-0.0618	1.0397	-0.1137	-0.4627	0.0602	0.0086	-0.1672	-0.0167	-0.0343	0.5171	0.0015	-0.0277	0.6676	0.0045	0.2745	119.3983	-168.3665	-192.119
103	5.7591	1.8531	-0.9966	0.715	-0.8756	2.325	-0.2447	1.4064	-0.52	-0.5161	0.3662	-0.4866	0.2126	-0.5107	0.0149	0.6352	-0.011	-0.0295	0.8389	-0.22	0.3716	118.5003	-173.9508	-198.2961
104	7.9538	1.0145	-0.6228	2.9171	0.2668	2.9514	0.1943	1.1972	0.6084	-0.6771	0.1747	0.445	-0.5619	0.6459	-0.17	0.4748	0.0426	-0.0128	0.6146	-0.0065	0.3954	125.4805	-163.8056	-195.7626
105	4.2239	-0.281	-0.0234	1.5391	0.536	3.3436	0.1386	0.5194	-0.251	-0.3685	-0.2529	0.1335	0.1323	0.2077	0.1617	0.5582	-0.078	-0.0087	0.6042	-0.0541	0.405	128.851	-170.5643	-191.3441
106	7.0537	-0.7075	1.8997	6.1165	-0.0609	7.8442	-0.0875	0.2508	-0.2052	-0.1982	0.0035	-1.0512	-0.195	1.8933	0.0902	0.4255	-0.1155	0.1542	0.5114	-0.1012	0.7328	164.1056	-159.043	-182.7287
107	7.7027	-1.3461	6.6106	2.0864	-0.644	6.1228	0.3016	-0.0897	-0.6281	-0.4587	0.0227	-0.1261	0.7536	-0.3569	-0.2557	0.6546	-0.1828	0.2438	0.6084	-0.0534	0.5174	154.527	-165.7954	-192.3921
108	2.8633	0.5607	1.5492	0.2985	-0.2941	2.8305	-0.4586	0.1044	-0.934	-0.5188	0.358	-0.7283	1.3187	-0.0713	0.309	0.9409	-0.0229	0.3581	0.559	-0.2503	1.0831	157.9958	-172.0651	-186.469
109	4.3668	0.7194	1.1375	1.4017	-1.1209	5.1811	-0.0576	0.5823	-0.3175	-0.0459	-0.0362	-0.0663	0.0094	-0.3431	0.1142	0.4794	0.0196	0.1274	0.5459	-0.1492	0.5316	152.4213	-161.8677	-188.6646
110	5.9159	-1.5305	0.795	1.7989	-1.3842	5.6186	-0.4721	0.5068	0.6804	-0.0167	-0.4039	-0.6577	0.7233	0.6862	0.4355	0.7307	0.1416	0.0335	0.6247	-0.1373	0.8258	166.6828	-169.7202	-188.3368
111	4.6397	-3.2527	4.1236	2.2355	-2.8909	3.7474	0.0143	1.1216	-0.0533	0.2049	-0.1606	-0.0066	0.3099	0.4626	0.0438	0.5923	-0.0069	0.1835	1.0144	-0.1922	0.9399	163.9772	-165.3267	-196.1878
112	1.7411	0.8434	-0.1489	4.9048	-1.6048	3.6205	-0.3726	0.0217	0.1875	0.276	0.0384	0.5753	-0.583	0.4076	0.3191	0.5188	-0.1621	0.0842	0.5427	-0.1116	0.749	115.8106	-189.4699	-85.8061
113	3.871	-0.2115	1.461	7.1041	-2.4947	3.4467	0.3315	-0.6795	0.4061	0.0226	-0.5269	-1.1492	-0.1395	0.4505	0.2007	0.5115	-0.2403	0.036	0.92	-0.0614	0.6333	130.8219	-191.5133	-90.8528
114	4.6417	-3.8531	0.6123	7.4967	-1.6272	2.4298	0.1785	0.7284	0.3599	0.2297	-0.6878	-1.1691	0.2698	0.9519	0.3997	0.8051	-0.1972	0.002	0.9648	-0.1113	0.6226	137.2581	-203.9224	-83.8925
115	2.8196	-0.7334	-0.0258	5.0436	-1.1513	4.2301	-0.1499	-0.2582	-0.1832	0.6632	0.2842	0.1862	-0.2652	0.441	-0.0506	0.7414	-0.096	-0.0009	0.8391	-0.2645	0.5168	124.5083	-203.4032	-74.2266
116	3.9521	-0.5945	1.3411	0.8035	-2.0867	5.7302	0.4399	0.0707	0.021	0.1921	0.1828	0.2024	0.6339	-0.5958	-0.5308	0.6466	-0.2002	0.0625	0.6334	-0.1751	0.7188	109.0801	-203.8549	-87.8926
117	4.7291	0.6569	0.1875	3.5517	-0.0718	9.2127	-0.1203	0.3268	0.776	0.0196	0.144	1.1466	-0.7761	-0.8137	0.119	0.4762	-0.0111	-0.0622	0.5907	-0.0679	0.9731	103.6231	-197.6287	-101.4746
118	4.4218	2.401	0.5025	6.5719	-0.3972	7.3188	0.3263	0.0883	1.1895	0.028	-0.0963	1.1661	-1.1809	-0.0415	-0.2138	0.5925	0.0401	0.0147	0.5307	-0.0478	0.7747	111.091	-186.7567	-99.145
119	4.3282	1.1697	0.5136	3.6472	-0.3855	2.7469	-0.0543	-0.0191	-0.3725	-0.0226	0.0734	0.1514	0.0958	-0.1306	0.0324	0.4434	-0.1202	-0.0276	0.543	-0.1731	0.4443	119.0513	-222.1173	-104.5301
120	4.2962	0.3271	0.2477	8.3825	0.9397	4.4812	-0.6372	-1.1885	-0.4466	0.3415	0.6668	0.5512	-0.6193	0.7873	-0.0219	0.5119	0.0545	-0.0416	0.7151	-0.0458	0.4238	124.9994	-226.5672	-88.4254
121	4.5373	-1.3894	2.3121	7.3334	0.4791	2.1296	-0.3806	-0.5418	-0.1966	1.0118	0.1985	-0.3358	0.0614	0.1502	0.1579	0.6936	-0.1229	0.1314	0.8134	-0.1541	0.4541	133.2443	-223.0484	-91.2671
122	6.1167	-1.8704	1.6625	4.5756	0.389	3.7675	-0.3932	-1.3461	0.2528	0.5765	-0.4628	-0.8936	1.2404	-0.2497	0.6187	0.7067	-0.0298	-0.0044	0.7533	-0.1862	0.6055	138.2885	-230.6353	-90.7708
123	3.5352	-1.3387	-0.665	4.5142	-0.1138	0.4436	0.1348	0.5369	0.2173	-0.1687	-0.0633	-0.252	-0.0262	0.0337	-0.0625	0.6063	-0.1175	0.005	0.6002	-0.0993	0.291	128.9792	-207.9704	-108.1497
124	0.7838	0.4281	-0.5612	3.7594	-0.2832	1.2295	-0.2969	0.861	0.3598	-0.4596	0.2976	0.4872	-0.4238	-0.4624	-0.0331	0.6401	-0.0725	-0.1133	0.9632	0.0069	0.4383	118.1316	-205.6921	-116.8101
125	7.8366	3.5435	-3.3159	4.5633	-1.559	3.7126	-0.0645	-0.0719	-0.4369	0.0092	-0.1882	0.338	0.1478	0.3994	0.198	0.3628	-0.0226	0.0079	0.7754	-0.0758	0.5679	88.6968	-224.0374	-90.2868
126	8.14	1.5754	-0.046	6.4428	-0.6218	5.4413	0.0551	-1.0141	-1.0732	0.4237	-0.359	-0.1432	0.0262	1.0435	0.3242	0.5191	-0.018	0.0922	0.849	0.0236	0.692	92.6596	-225.4391	-85.1288
127	8.3976	2.3583	-2.5178	5.0619	-3.1692	4.8616	-1.0296	1.4534	0.9135	-0.6247	1.0984	0.2237	-0.0097	0.1244	-0.1289	0.4319	-0.1231	-0.0543	0.7	-0.1805	0.911	89.5414	-212.9807	-94.6968
128	7.915	4.5528	-2.0013	7.0236	-2.7039	3.7266	-0.471	0.5736	-2.5799	0.2898	0.1121	-0.4537	1.1103	-1.0727	-0.0527	0.7725	-0.2256	-0.0097	0.7822	-0.0993	1.6188	76.0323	-238.6071	-82.0088
129	3.1859	1.1646	1.2689	0.6773	1.1297	2.0921	-0.2749	0.9468	-2.0124	-0.5978	-0.5055	0.1812	0.4086	0.594	0.7215	0.923	0.0528	0.0055	2.1056	-0.1442	1.8521	58.4877	-238.068	-85.9833
130	0.3369	0.2681	-0.1613	8.317	2.7819	1.1193	-1.1018	1.1167	-0.3709	-0.4883	0.0373	1.7748	-0.1242	0.6774	0.6529	1.0811	0.0147	-0.081	1.952	0.2888	2.1421	54.4043	-232.3333	-96.0775
131	5.4245	-0.2305	-3.5654	4.7588	2.7509	3.8111	-0.3257	-0.2497	-0.9954	1.1535	0.6037	1.2645	1.3078	0.036	-0.0312	1.149	0.1596	0.395	1.363	0.2114	1.9398	66.2094	-234.2078	-78.4944
132	0.5476	-1.483	-1.2668	3.9963	3.5804	3.1526	-0.2574	0.0503	-1.4948	-0.8074	-0.1248	2.9031	0.3923	-2.3046	0.5221	1.1445	-0.0795	-0.2408	2.2617	-0.2534	2.6999	46.1205	-235.2878	-92.132
133	1.0008	-0.8184	0.8405	0.7396	-0.3816	1.8286	1.8435	0.507	0.2051	0.1399	0.2934	0.6276	1.2025	0.8437	-1.5093	1.0985	0.0043	0.1981	2.5038	-0.1011	2.5832	56.7433	-244.0846	-89.6967
134	2.1937	-0.7436	-1.0879	0.2683	0.4	0.8861	0.0344	-0.5619	0.5885	0.5991	0.0652	2.6378	-0.0823	-0.2254	-0.2205	0.467	-0.1465	0.5404	1.1597	-0.1483	2.8924	71.2805	-204.6603	-82.1986
135	0.667	0.9226	-1.7754	1.2843	-2.3918	4.4594	0.9712	-1.2764	2.1282	1.1755	0.3584	1.4472	-1.3444	-0.5538	-0.5518	0.6323	-0.0424	0.3308	0.8744	-0.6837	2.2335	81.6105	-204.0125	-83.3212
136	4.9271	0.6437	-2.6872	3.9269	-1.5235	4.2318	-0.091	1.4871	2.3936	-0.491	0.4812	2.1527	-0.4468	-0.5634	-0.6022	0.7248	-0.0791	-0.2048	0.9116	0.3701	1.8702	78.8779	-207.1556	-95.2854
137	5.2301	1.5068	-3.1256	2.9788	-0.9935	2.4145	0.4699	-0.6163	2.2	0.6586	0.1386	2.1432	-0.7056	-0.2545	-0.5373	0.6349	-0.1628	0.2478	0.8646	-0.2953	2.2889	79.8888	-205.0635	-86.2328
138	0.6208	-0.1827	0.3728	0.111	-0.1467	0.2435	-0.0042	0.6006	1.1368	-0.3551	0.3372	0.8659	-0.4708	-1.3335	-0.0024	0.1187	0.0296	0.408	1.8641	0.1486	3.4579	57.2432	-210.6312	-85.4035
139	5.658	5.6464	-1.3848	6.8357	-1.2072	5.3397	-0.3428	0.8556	-0.6122	1.2533	0.7517	1.532	0.2722	-0.8679	-0.7247	0.9816	-0.1197	0.4544	1.2714	-0.0729	1.7769	49.6592	-239.6465	-78.598
140	4.9928	-0.2457	1.0135	2.095	2.9143	4.5023	0.0986	-0.3384	0.9811	0.4324	-0.112	0.8349	-0.3297	-0.5008	0.0011	0.8332	-0.193	0.2496	1.2386	-0.0191	1.7116	52.8118	-224.8542	-76.485
141	6.2572	-0.3717	4.4525	2.0913	-0.1681	3.161	-0.5861	0.2075	0.4156	1.7585	0.0668	0.3975	0.764	-2.8297	0.477	1.3179	-0.2829	0.4775	1.7574	-0.4543	1.6202	55.1616	-229.6995	-68.8935
142	1.9683	-1.6788	0.5317	2.3551	-0.6246	3.3862	0.1984	-0.1056	-0.9304	0.4576	0.9987	0.814	-0.3114	-1.2343	-1.331	0.5978	-0.1119	0.0638	1.6493	0.0465	1.9472	55.8295	-227.8508	-80.622
143	0.1063	0.0463	0.1105	0.0192	-0.025	0.1444	0.6725	-2.2535	1.2556	-0.1824	0.3146	-1.1004	-0.1843	0.0004	-0.8596	1.4697	-0.772	0.2632	2.4018	-0.0046	2.3023	46.9811	-233.542	-68.0815
144	1.1852	0.8493	1.8794	2.4353	-1.8403	8.8503	-0.5031	-0.2114	0.6432	1.0157	0.4344	-0.0276	0.8519	-2.2772	0.3147	1.5474	0.0541	0.9986	1.1092	-0.1797	3.1288	43.2525	-226.9606	-74.036
145	3.9658	0.2727	1.1494	4.7801	0.8929	2.5353	0.0246	-0.2474	-0.1045	0.1228	0.1036	0.0824	0.2941	0.2734	-0.124	0.5494	-0.1168	0.022	0.9113	-0.161	0.2649	152.9319	-194.0005	-102.6533
146	4.1486	1.6428	1.856	1.851	0.0994	1.4771	0.1324	-0.6479	-0.0088	-0.1571	0.0889	-0.0171	0.1028	0.2683	-0.2437	0.6044	-0.0564	0.0135	0.8133	-0.1547	0.3719	152.4387	-193.4769	-103.8257
147	2.6735	1.7129	-1.0362	0.758	-0.7198	0.4136	-0.1398	-0.4903	0.6903	-0.4116	0.2498	-0.2007	-0.018	0.6265	-0.2363	0.8087	-0.3124	0.1937	1.2381	-0.3944	0.6437	176.0099	-183.8074	-113.4392
148	2.0255	1.8503	1.2533	4.5448	-2.7411	6.1494	-0.3928	0.0303	0.1621	-0.1042	0.3788	-0.4981	-0.4858	-0.2394	-0.1161	0.8081	-0.2797	0.2231	1.2119	-0.355	0.7415	181.0866	-179.7523	-115.5072
149	2.7303	0.6922	1.3172	1.7478	0.5176	3.7977	-0.1069	-0.2856	-0.1528	-0.6393	1.1105	-1.073	-0.3357	0.7877	-0.0549	1.4567	-1.2463	0.3472	1.4152	-1.037	0.9836	185.2467	-177.7336	-122.7014
150	3.437	-0.3535	2.754	1.483	-0.4521	2.247	-0.0382	-0.3046	-0.2337	-1.1907	0.3034	-0.0892	-0.2326	0.0373	0.3292	1.3893	-0.4293	0.1884	1.2896	-0.573	0.7497	185.3066	-171.0167	-115.5414
151	4.6974	2.2048	3.0286	8.0114	-3.9612	6.177	0.4151	0.2263	-0.7968	1.2022	-1.6975	0.0936	-0.0777	-0.5357	1.0011	0.7997	-0.2884	0.2893	1.0534	-0.3956	0.902	191.9165	-172.733	-114.4501
152	5.0009	1.305	-1.7563	2.2827	-2.4155	3.3588	-0.4801	0.4467	-0.24	-0.9226	0.3265	-0.6863	1.2123	0.2024	0.035	0.9377	-0.0998	0.1226	0.6278	-0.2093	0.4845	158.8317	-199.1187	-128.6356
153	3.9492	-0.0367	-2.3959	1.906	0.7072	5.4677	-0.1897	0.6785	0.0306	-0.4933	0.1803	-0.0522	0.101	0.0468	0.0094	0.7978	-0.2648	0.0039	0.7074	-0.1192	0.3473	149.66	-195.2895	-123.4956
154	3.7573	0.3966	-0.6635	1.1834	0.434	3.633	-0.1465	0.805	-0.1476	-0.5446	0.3249	-0.1508	0.2208	0.0396	-0.1923	0.8042	-0.2424	0.0798	0.8024	-0.2147	0.4409	151.6143	-198.1339	-123.9572
155	1.8362	1.7357	-1.3005	2.0983	-1.3909	0.9232	-0.4072	0.4124	0.6213	-0.4956	0.782	-0.6039	-0.149	1.3912	0.2531	0.7683	-0.2746	0.3919	1.4139	-0.6361	1.0695	183.4441	-186.3756	-125.0777
156	0.74	1.1414	-0.2058	6.2105	-1.5189	3.4882	-0.0376	-0.7104	-0.1015	-1.3904	0.5571	-0.1291	0.6851	1.561	-0.2456	0.8863	-0.1733	0.3758	1.3849	-0.3913	0.8327	184.2945	-191.6061	-126.007
157	4.6656	-2.7111	-0.3934	7.4913	0.9071	4.1817	-0.304	-0.596	-0.3208	-0.5774	0.038	-1.2854	0.0541	1.3237	0.1321	0.7601	-0.1821	0.4235	1.0266	-0.1158	1.0667	188.1118	-197.7415	-120.1294
158	6.7855	-0.1438	0.561	2.8963	-0.6514	5.8819	-0.53	-2.1775	-0.1539	-0.2117	0.7802	0.1362	-0.6199	0.7318	-0.014	1.0073	-0.2169	0.4342	1.2411	-0.408	0.6884	182.3876	-187.5697	-122.4301
159	0.4337	1.8561	-0.2248	7.645	-0.9742	0.1095	-0.133	-3.9289	-1.8499	-0.0077	0.8479	-0.6431	0.6658	0.496	-0.3651	0.7328	-0.1113	0.0274	2.5282	-0.4219	1.1242	196.9197	-195.0656	-122.9357
160	4.3156	-1.1218	-1.4817	1.3168	-1.0758	2.5048	-0.464	0.3649	-0.6231	0.1111	0.5855	-0.2391	0.8897	2.41	0.3953	1.2298	-0.4591	0.6561	2.1065	-0.755	1.2925	193.452	-190.9701	-130.5946
161	3.9546	0.8393	-4.9085	6.3281	-3.326	7.29	0.6022	-0.9696	-0.703	-0.6857	-1.4243	0.1169	0.6545	1.8374	0.4671	1.2803	0.2782	-0.0206	1.1947	0.2033	1.6924	98.3942	-272.8006	-123.7245
162	0.1163	-0.1317	0.1888	0.1482	-0.2125	0.2996	0.4667	-0.1292	0.3365	1.1565	-0.4399	-0.0588	-0.806	0.4634	-0.3283	1.4957	0.1796	0.1627	1.8651	0.0379	1.1194	68.7544	-190.4605	-52.5166
163	5.8433	2.8995	0.203	2.7179	-0.973	0.9147	0.5311	0.647	-0.0581	0.0343	-0.2288	1.1332	0.0031	0.8498	0.1251	1.5399	-0.6761	-0.3964	2.2505	0.4455	1.3116	99.1667	-191.2031	-145.7319
164	0.1719	-0.219	0.2527	1.4969	-0.703	0.4498	-0.6051	0.9521	0.072	-0.3205	0.1179	0.0483	-0.3135	0.1587	0.078	1.3655	-1.1896	-0.4001	2.9234	0.8853	2.9658	132.5245	-218.7767	-76.8178

Refinement TLS group

ID	Refine-ID	Refine TLS-ID	Selection details	Auth asym-ID
1	X-RAY DIFFRACTION	1	chain 'A' and (resid 4 through 89 )	A
2	X-RAY DIFFRACTION	2	chain 'A' and (resid 90 through 135 )	A
3	X-RAY DIFFRACTION	3	chain 'A' and (resid 136 through 178 )	A
4	X-RAY DIFFRACTION	4	chain 'A' and (resid 179 through 230 )	A
5	X-RAY DIFFRACTION	5	chain 'A' and (resid 231 through 285 )	A
6	X-RAY DIFFRACTION	6	chain 'A' and (resid 286 through 350 )	A
7	X-RAY DIFFRACTION	7	chain 'B' and (resid 4 through 98 )	B
8	X-RAY DIFFRACTION	8	chain 'B' and (resid 99 through 178 )	B
9	X-RAY DIFFRACTION	9	chain 'B' and (resid 179 through 285 )	B
10	X-RAY DIFFRACTION	10	chain 'B' and (resid 286 through 352 )	B
11	X-RAY DIFFRACTION	11	chain 'C' and (resid 4 through 128 )	C
12	X-RAY DIFFRACTION	12	chain 'C' and (resid 129 through 225 )	C
13	X-RAY DIFFRACTION	13	chain 'D' and (resid 2 through 19 )	D
14	X-RAY DIFFRACTION	14	chain 'D' and (resid 20 through 91 )	D
15	X-RAY DIFFRACTION	15	chain 'D' and (resid 92 through 116 )	D
16	X-RAY DIFFRACTION	16	chain 'D' and (resid 117 through 153 )	D
17	X-RAY DIFFRACTION	17	chain 'D' and (resid 154 through 166 )	D
18	X-RAY DIFFRACTION	18	chain 'D' and (resid 167 through 201 )	D
19	X-RAY DIFFRACTION	19	chain 'D' and (resid 202 through 217 )	D
20	X-RAY DIFFRACTION	20	chain 'E' and (resid 4 through 20 )	E
21	X-RAY DIFFRACTION	21	chain 'E' and (resid 21 through 55 )	E
22	X-RAY DIFFRACTION	22	chain 'E' and (resid 56 through 76 )	E
23	X-RAY DIFFRACTION	23	chain 'E' and (resid 77 through 128 )	E
24	X-RAY DIFFRACTION	24	chain 'E' and (resid 129 through 144 )	E
25	X-RAY DIFFRACTION	25	chain 'E' and (resid 145 through 166 )	E
26	X-RAY DIFFRACTION	26	chain 'E' and (resid 167 through 203 )	E
27	X-RAY DIFFRACTION	27	chain 'E' and (resid 204 through 225 )	E
28	X-RAY DIFFRACTION	28	chain 'F' and (resid 3 through 19 )	F
29	X-RAY DIFFRACTION	29	chain 'F' and (resid 20 through 91 )	F
30	X-RAY DIFFRACTION	30	chain 'F' and (resid 92 through 116 )	F
31	X-RAY DIFFRACTION	31	chain 'F' and (resid 117 through 189 )	F
32	X-RAY DIFFRACTION	32	chain 'F' and (resid 190 through 217 )	F
33	X-RAY DIFFRACTION	33	chain 'G' and (resid 4 through 30 )	G
34	X-RAY DIFFRACTION	34	chain 'G' and (resid 31 through 99 )	G
35	X-RAY DIFFRACTION	35	chain 'G' and (resid 100 through 178 )	G
36	X-RAY DIFFRACTION	36	chain 'G' and (resid 179 through 262 )	G
37	X-RAY DIFFRACTION	37	chain 'G' and (resid 263 through 285 )	G
38	X-RAY DIFFRACTION	38	chain 'G' and (resid 286 through 350 )	G
39	X-RAY DIFFRACTION	39	chain 'H' and (resid 5 through 98 )	H
40	X-RAY DIFFRACTION	40	chain 'H' and (resid 99 through 152 )	H
41	X-RAY DIFFRACTION	41	chain 'H' and (resid 153 through 230 )	H
42	X-RAY DIFFRACTION	42	chain 'H' and (resid 231 through 352 )	H
43	X-RAY DIFFRACTION	43	chain 'I' and (resid 1 through 28 )	I
44	X-RAY DIFFRACTION	44	chain 'I' and (resid 29 through 128 )	I
45	X-RAY DIFFRACTION	45	chain 'I' and (resid 129 through 225 )	I
46	X-RAY DIFFRACTION	46	chain 'J' and (resid 3 through 19 )	J
47	X-RAY DIFFRACTION	47	chain 'J' and (resid 20 through 91 )	J
48	X-RAY DIFFRACTION	48	chain 'J' and (resid 92 through 104 )	J
49	X-RAY DIFFRACTION	49	chain 'J' and (resid 105 through 116 )	J
50	X-RAY DIFFRACTION	50	chain 'J' and (resid 117 through 153 )	J
51	X-RAY DIFFRACTION	51	chain 'J' and (resid 154 through 166 )	J
52	X-RAY DIFFRACTION	52	chain 'J' and (resid 167 through 201 )	J
53	X-RAY DIFFRACTION	53	chain 'J' and (resid 202 through 217 )	J
54	X-RAY DIFFRACTION	54	chain 'K' and (resid 5 through 76 )	K
55	X-RAY DIFFRACTION	55	chain 'K' and (resid 77 through 128 )	K
56	X-RAY DIFFRACTION	56	chain 'K' and (resid 129 through 154 )	K
57	X-RAY DIFFRACTION	57	chain 'K' and (resid 155 through 166 )	K
58	X-RAY DIFFRACTION	58	chain 'K' and (resid 167 through 184 )	K
59	X-RAY DIFFRACTION	59	chain 'K' and (resid 185 through 203 )	K
60	X-RAY DIFFRACTION	60	chain 'K' and (resid 204 through 225 )	K
61	X-RAY DIFFRACTION	61	chain 'L' and (resid 3 through 19 )	L
62	X-RAY DIFFRACTION	62	chain 'L' and (resid 20 through 62 )	L
63	X-RAY DIFFRACTION	63	chain 'L' and (resid 63 through 91 )	L
64	X-RAY DIFFRACTION	64	chain 'L' and (resid 92 through 104 )	L
65	X-RAY DIFFRACTION	65	chain 'L' and (resid 105 through 116 )	L
66	X-RAY DIFFRACTION	66	chain 'L' and (resid 117 through 153 )	L
67	X-RAY DIFFRACTION	67	chain 'L' and (resid 154 through 166 )	L
68	X-RAY DIFFRACTION	68	chain 'L' and (resid 167 through 189 )	L
69	X-RAY DIFFRACTION	69	chain 'L' and (resid 190 through 217 )	L
70	X-RAY DIFFRACTION	70	chain 'M' and (resid 4 through 135 )	M
71	X-RAY DIFFRACTION	71	chain 'M' and (resid 136 through 230 )	M
72	X-RAY DIFFRACTION	72	chain 'M' and (resid 231 through 350 )	M
73	X-RAY DIFFRACTION	73	chain 'N' and (resid 2 through 81 )	N
74	X-RAY DIFFRACTION	74	chain 'N' and (resid 82 through 135 )	N
75	X-RAY DIFFRACTION	75	chain 'N' and (resid 136 through 262 )	N
76	X-RAY DIFFRACTION	76	chain 'N' and (resid 263 through 285 )	N
77	X-RAY DIFFRACTION	77	chain 'N' and (resid 286 through 352 )	N
78	X-RAY DIFFRACTION	78	chain 'O' and (resid 3 through 20 )	O
79	X-RAY DIFFRACTION	79	chain 'O' and (resid 21 through 76 )	O
80	X-RAY DIFFRACTION	80	chain 'O' and (resid 77 through 128 )	O
81	X-RAY DIFFRACTION	81	chain 'O' and (resid 129 through 154 )	O
82	X-RAY DIFFRACTION	82	chain 'O' and (resid 155 through 166 )	O
83	X-RAY DIFFRACTION	83	chain 'O' and (resid 167 through 197 )	O
84	X-RAY DIFFRACTION	84	chain 'O' and (resid 198 through 212 )	O
85	X-RAY DIFFRACTION	85	chain 'O' and (resid 213 through 225 )	O
86	X-RAY DIFFRACTION	86	chain 'P' and (resid 2 through 19 )	P
87	X-RAY DIFFRACTION	87	chain 'P' and (resid 20 through 104 )	P
88	X-RAY DIFFRACTION	88	chain 'P' and (resid 105 through 116 )	P
89	X-RAY DIFFRACTION	89	chain 'P' and (resid 117 through 153 )	P
90	X-RAY DIFFRACTION	90	chain 'P' and (resid 154 through 166 )	P
91	X-RAY DIFFRACTION	91	chain 'P' and (resid 167 through 177 )	P
92	X-RAY DIFFRACTION	92	chain 'P' and (resid 178 through 191 )	P
93	X-RAY DIFFRACTION	93	chain 'P' and (resid 192 through 217 )	P
94	X-RAY DIFFRACTION	94	chain 'Q' and (resid 5 through 42 )	Q
95	X-RAY DIFFRACTION	95	chain 'Q' and (resid 43 through 76 )	Q
96	X-RAY DIFFRACTION	96	chain 'Q' and (resid 77 through 133 )	Q
97	X-RAY DIFFRACTION	97	chain 'Q' and (resid 134 through 144 )	Q
98	X-RAY DIFFRACTION	98	chain 'Q' and (resid 145 through 184 )	Q
99	X-RAY DIFFRACTION	99	chain 'Q' and (resid 185 through 203 )	Q
100	X-RAY DIFFRACTION	100	chain 'Q' and (resid 204 through 225 )	Q
101	X-RAY DIFFRACTION	101	chain 'R' and (resid 2 through 19 )	R
102	X-RAY DIFFRACTION	102	chain 'R' and (resid 20 through 62 )	R
103	X-RAY DIFFRACTION	103	chain 'R' and (resid 63 through 76 )	R
104	X-RAY DIFFRACTION	104	chain 'R' and (resid 77 through 91 )	R
105	X-RAY DIFFRACTION	105	chain 'R' and (resid 92 through 116 )	R
106	X-RAY DIFFRACTION	106	chain 'R' and (resid 117 through 131 )	R
107	X-RAY DIFFRACTION	107	chain 'R' and (resid 132 through 153 )	R
108	X-RAY DIFFRACTION	108	chain 'R' and (resid 154 through 166 )	R
109	X-RAY DIFFRACTION	109	chain 'R' and (resid 167 through 189 )	R
110	X-RAY DIFFRACTION	110	chain 'R' and (resid 190 through 200 )	R
111	X-RAY DIFFRACTION	111	chain 'R' and (resid 201 through 217 )	R
112	X-RAY DIFFRACTION	112	chain 'S' and (resid 4 through 55 )	S
113	X-RAY DIFFRACTION	113	chain 'S' and (resid 56 through 81 )	S
114	X-RAY DIFFRACTION	114	chain 'S' and (resid 82 through 135 )	S
115	X-RAY DIFFRACTION	115	chain 'S' and (resid 136 through 230 )	S
116	X-RAY DIFFRACTION	116	chain 'S' and (resid 231 through 262 )	S
117	X-RAY DIFFRACTION	117	chain 'S' and (resid 263 through 305 )	S
118	X-RAY DIFFRACTION	118	chain 'S' and (resid 306 through 350 )	S
119	X-RAY DIFFRACTION	119	chain 'T' and (resid 2 through 97 )	T
120	X-RAY DIFFRACTION	120	chain 'T' and (resid 98 through 154 )	T
121	X-RAY DIFFRACTION	121	chain 'T' and (resid 155 through 211 )	T
122	X-RAY DIFFRACTION	122	chain 'T' and (resid 212 through 230 )	T
123	X-RAY DIFFRACTION	123	chain 'T' and (resid 231 through 285 )	T
124	X-RAY DIFFRACTION	124	chain 'T' and (resid 286 through 351 )	T
125	X-RAY DIFFRACTION	125	chain 'U' and (resid 4 through 55 )	U
126	X-RAY DIFFRACTION	126	chain 'U' and (resid 56 through 100 )	U
127	X-RAY DIFFRACTION	127	chain 'U' and (resid 101 through 115 )	U
128	X-RAY DIFFRACTION	128	chain 'U' and (resid 116 through 128 )	U
129	X-RAY DIFFRACTION	129	chain 'U' and (resid 129 through 163 )	U
130	X-RAY DIFFRACTION	130	chain 'U' and (resid 164 through 174 )	U
131	X-RAY DIFFRACTION	131	chain 'U' and (resid 175 through 186 )	U
132	X-RAY DIFFRACTION	132	chain 'U' and (resid 187 through 203 )	U
133	X-RAY DIFFRACTION	133	chain 'U' and (resid 204 through 225 )	U
134	X-RAY DIFFRACTION	134	chain 'V' and (resid 3 through 19 )	V
135	X-RAY DIFFRACTION	135	chain 'V' and (resid 20 through 39 )	V
136	X-RAY DIFFRACTION	136	chain 'V' and (resid 40 through 62 )	V
137	X-RAY DIFFRACTION	137	chain 'V' and (resid 63 through 104 )	V
138	X-RAY DIFFRACTION	138	chain 'V' and (resid 105 through 116 )	V
139	X-RAY DIFFRACTION	139	chain 'V' and (resid 117 through 131 )	V
140	X-RAY DIFFRACTION	140	chain 'V' and (resid 132 through 153 )	V
141	X-RAY DIFFRACTION	141	chain 'V' and (resid 154 through 166 )	V
142	X-RAY DIFFRACTION	142	chain 'V' and (resid 167 through 189 )	V
143	X-RAY DIFFRACTION	143	chain 'V' and (resid 190 through 200 )	V
144	X-RAY DIFFRACTION	144	chain 'V' and (resid 201 through 217 )	V
145	X-RAY DIFFRACTION	145	chain 'W' and (resid 5 through 76 )	W
146	X-RAY DIFFRACTION	146	chain 'W' and (resid 77 through 108 )	W
147	X-RAY DIFFRACTION	147	chain 'W' and (resid 109 through 143 )	W
148	X-RAY DIFFRACTION	148	chain 'W' and (resid 144 through 184 )	W
149	X-RAY DIFFRACTION	149	chain 'W' and (resid 185 through 197 )	W
150	X-RAY DIFFRACTION	150	chain 'W' and (resid 198 through 212 )	W
151	X-RAY DIFFRACTION	151	chain 'W' and (resid 213 through 225 )	W
152	X-RAY DIFFRACTION	152	chain 'X' and (resid 2 through 19 )	X
153	X-RAY DIFFRACTION	153	chain 'X' and (resid 20 through 62 )	X
154	X-RAY DIFFRACTION	154	chain 'X' and (resid 63 through 104 )	X
155	X-RAY DIFFRACTION	155	chain 'X' and (resid 105 through 131 )	X
156	X-RAY DIFFRACTION	156	chain 'X' and (resid 132 through 153 )	X
157	X-RAY DIFFRACTION	157	chain 'X' and (resid 154 through 166 )	X
158	X-RAY DIFFRACTION	158	chain 'X' and (resid 167 through 189 )	X
159	X-RAY DIFFRACTION	159	chain 'X' and (resid 190 through 200 )	X
160	X-RAY DIFFRACTION	160	chain 'X' and (resid 201 through 217 )	X
161	X-RAY DIFFRACTION	161	chain 'a' and (resid 1 through 20 )	a
162	X-RAY DIFFRACTION	162	chain 'g' and (resid 3 through 16 )	g
163	X-RAY DIFFRACTION	163	chain 'm' and (resid 2 through 20 )	m
164	X-RAY DIFFRACTION	164	chain 's' and (resid 0 through 20 )	s

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

Version 3 of the EMDB header file is now the official format.
The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

+
Jul 12, 2017. Major update of PDB

-
Yorodumi

Thousand views of thousand structures

Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

-
Movie

-
Structure viewers

+
Viewer log

-
This page

-
This web site

-
Options

+
Open data

-
Basic information

-
Structure visualization

-
Downloads & links

-
Download

-
Validation report

-
Related structure data

-
Links

-
Assembly

-
Components

-
Antibody , 2 types, 16 molecules CEIKOQUWDFJLPRVX

-
Protein / Protein/peptide , 2 types, 12 molecules ABGHMNSTagms

-
Non-polymers , 5 types, 453 molecules

-
Details

-
Experimental details

-
Experiment

-
Sample preparation

-
Data collection

-
Processing

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

-
Aug 12, 2020. Covid-19 info

+
Mar 5, 2020. Novel coronavirus structure data

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

+
Jul 12, 2017. Major update of PDB

-
Yorodumi

-Movie

-Structure viewers

+Viewer log

-This page

-This web site

-Options

+Open data

-Basic information

-Structure visualization

-Downloads & links

-Download

-Validation report

-Related structure data

-Links

-Assembly

-Components

-Antibody , 2 types, 16 molecules CEIKOQUWDFJLPRVX

-Protein / Protein/peptide , 2 types, 12 molecules ABGHMNSTagms

-Non-polymers , 5 types, 453 molecules

-Details

-Experimental details

-Experiment

-Sample preparation

-Data collection

-Processing

+About Yorodumi

-News

-Feb 9, 2022. New format data for meta-information of EMDB entries

-Aug 12, 2020. Covid-19 info

+Mar 5, 2020. Novel coronavirus structure data

+Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

+Jul 12, 2017. Major update of PDB

-Yorodumi

-
Movie

-
Structure viewers

+
Viewer log

-
This page

-
This web site

-
Options

+
Open data

-
Basic information

-
Structure visualization

-
Downloads & links

-
Download

-
Validation report

-
Related structure data

-
Links

-
Assembly

-
Components

-
Antibody , 2 types, 16 molecules CEIKOQUWDFJLPRVX

-
Protein / Protein/peptide , 2 types, 12 molecules ABGHMNSTagms

-
Non-polymers , 5 types, 453 molecules

-
Details

-
Experimental details

-
Experiment

-
Sample preparation

-
Data collection

-
Processing

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

-
Aug 12, 2020. Covid-19 info

+
Mar 5, 2020. Novel coronavirus structure data

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

+
Jul 12, 2017. Major update of PDB

-
Yorodumi