[English] 日本語
Yorodumi
- PDB-8p60: Spraguea lophii ribosome dimer -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 8p60
TitleSpraguea lophii ribosome dimer
Components
  • (40S ribosomal protein ...) x 28
  • (60S ribosomal protein ...) x 28
  • (Ribosomal protein ...) x 9
  • DNL-type domain-containing protein
  • Guanine nucleotide binding protein beta subunit
  • RNA 16S
  • RNA 28S
  • RNA 5S
  • Ribosomal L29 protein
  • S60 ribosomal protein L10
  • Transposase
  • Ubiquitin/40s ribosomal protein S27a fusion
  • Ubiquitin
KeywordsRIBOSOME / Microsporidia
Function / homology
Function and homology information


translation regulator activity / cytosolic ribosome / ribosome binding / large ribosomal subunit / small ribosomal subunit / 5S rRNA binding / cytosolic large ribosomal subunit / rRNA binding / ribosome / structural constituent of ribosome ...translation regulator activity / cytosolic ribosome / ribosome binding / large ribosomal subunit / small ribosomal subunit / 5S rRNA binding / cytosolic large ribosomal subunit / rRNA binding / ribosome / structural constituent of ribosome / ribonucleoprotein complex / translation / RNA binding / zinc ion binding / membrane / metal ion binding / nucleus / cytosol / cytoplasm
Similarity search - Function
CXXC motif containing zinc binding protein, eukaryotic / CXXC motif containing zinc binding protein, eukaryotic / Small (40S) ribosomal subunit Asc1/RACK1 / Ribosomal protein S26e / Ribosomal protein S26e superfamily / S27a-like superfamily / Ribosomal protein S26e / Ribosomal protein S25 / 40S ribosomal protein S29/30S ribosomal protein S14 type Z / Ribosomal protein S27a ...CXXC motif containing zinc binding protein, eukaryotic / CXXC motif containing zinc binding protein, eukaryotic / Small (40S) ribosomal subunit Asc1/RACK1 / Ribosomal protein S26e / Ribosomal protein S26e superfamily / S27a-like superfamily / Ribosomal protein S26e / Ribosomal protein S25 / 40S ribosomal protein S29/30S ribosomal protein S14 type Z / Ribosomal protein S27a / Ribosomal protein S27a / Ribosomal protein S21e / Ribosomal protein S21e superfamily / Ribosomal protein S21e / Ribosomal protein L10e, conserved site / Ribosomal protein L10e / S25 ribosomal protein / Ribosomal protein S19A/S15e / Ribosomal protein S27a / Ribosomal protein S2, eukaryotic/archaeal / Ribosomal protein S19e / Ribosomal_S19e / Ribosomal protein S5, eukaryotic/archaeal / 40S ribosomal protein S11, N-terminal / Ribosomal protein L34e, conserved site / Ribosomal protein S7e / Ribosomal protein S4e, N-terminal, conserved site / 40S ribosomal protein S4, C-terminal domain / Ribosomal protein L44e / Ribosomal protein L27e / Ribosomal protein L27e superfamily / Ribosomal protein L22e / Ribosomal protein L22e superfamily / Ribosomal protein S19e / Ribosomal L22e protein family / 40S Ribosomal protein S10 / 40S ribosomal protein S4 C-terminus / Ribosomal protein S4e, N-terminal / Ribosomal_S17 N-terminal / Ribosomal protein L44 / Ribosomal protein L34Ae / Plectin/S10, N-terminal / Ribosomal protein S7e / Ribosomal L27e protein family / Plectin/S10 domain / Ribosomal protein S8e / Ribosomal protein S4, KOW domain / Ribosomal protein S5/S7, eukaryotic/archaeal / Ribosomal protein S4e / Ribosomal protein S4e, central region / Ribosomal protein S4e, central domain superfamily / Ribosomal protein L30/YlxQ / Ribosomal protein S13/S15, N-terminal / Ribosomal protein S15P / Ribosomal S13/S15 N-terminal domain / Ribosomal protein S4/S9, eukaryotic/archaeal / Ribosomal protein L34e / Ribosomal protein L13e / Ribosomal protein L13e / RS4NT (NUC023) domain / 60S ribosomal protein L6E / Ribosomal L40e family / Ribosomal protein L35A / Ribosomal protein L36e / Ribosomal protein L36e domain superfamily / Ribosomal protein L36e / Ribosomal protein L35A superfamily / Ribosomal protein L44e signature. / Ribosomal_L40e / Ribosomal protein L40e / Ribosomal protein L40e superfamily / Ribosomal protein L10e signature. / Ribosomal protein L32e, conserved site / Ribosomal family S4e / Ribosomal protein L7A/L8 / Ribosomal S13/S15 N-terminal domain / 60S ribosomal protein L18a/ L20, eukaryotes / Ribosomal protein S4e signature. / Ribosomal protein L35Ae / 50S ribosomal protein L18Ae/60S ribosomal protein L20 and L18a / Ribosomal protein L34e signature. / Ribosomal protein 50S-L18Ae/60S-L20/60S-L18A / Ribosomal protein L5 eukaryotic, C-terminal / Ribosomal L18 C-terminal region / Ribosomal proteins 50S-L18Ae/60S-L20/60S-L18A / Ribosomal protein L31e / Ribosomal protein L31e domain superfamily / Ribosomal_L31e / Ribosomal protein L21e / Ribosomal protein L21e, conserved site / Ribosomal protein L21 superfamily / Ribosomal protein 60S L18 and 50S L18e / 60S ribosomal protein L19 / Ribosomal protein L3, domain 3, archaeal type superfamily / Ribosomal protein L3, archaeal/eukaryotic type / Ribosomal protein L21e / Ribosomal_L15e / Ribosomal protein L31e / Ribosomal protein L15e / Ribosomal protein L15e core domain superfamily
Similarity search - Domain/homology
RNA / RNA (> 10) / RNA (> 100) / RNA (> 1000) / 40S ribosomal protein S5 / Uncharacterized protein / 60S ribosomal protein L6 / 60S ribosomal protein L35a / 40S ribosomal protein S14 / Ribosomal protein L15 ...RNA / RNA (> 10) / RNA (> 100) / RNA (> 1000) / 40S ribosomal protein S5 / Uncharacterized protein / 60S ribosomal protein L6 / 60S ribosomal protein L35a / 40S ribosomal protein S14 / Ribosomal protein L15 / Ribosomal protein L34 / 40S ribosomal protein S12 / 40S Ribosomal protein S19 / 40S ribosomal protein S2 / 60S ribosomal protein L26 / 40S ribosomal protein S9 / 60s ribosomal protein L21 / 40s ribosomal protein s24 / 40S ribosomal protein S11 / 40S ribosomal protein S0 / 60S ribosomal protein L7 / Large ribosomal subunit protein eL22 / 40S ribosomal protein S20 / 40S ribosomal protein S26 / Ubiquitin/40s ribosomal protein S27a fusion / Ribosomal protein S21E / 60S ribosomal protein L20 / 60S ribosomal protein L18 / 40S ribosomal protein S25 / 40S ribosomal protein S3 / 60S ribosomal protein L3 / 60S ribosomal protein L11 / S60 ribosomal protein L10 / 60S ribosomal protein L19 / 60S ribosomal protein L4 / 60S ribosomal protein L17 / 40S ribosomal protein S16 / 60S ribosomal protein L36 / 60S ribosomal protein L3 / 60S ribosomal protein L23a / 40S ribosomal protein S4 / 40S ribosomal protein S8 / 60S ribosomal protein L5 / 40S ribosomal protein S18 / 40S ribosomal protein S29 / 40S ribosomal protein S15A / 60S ribosomal protein L32 / Ribosomal protein S19 / 60S ribosomal protein L44 / Ribosomal protein L23 / 60S ribosomal protein L9 / Ubiquitin / Ribosomal protein L24E / 60S ribosomal protein L39 / 60S ribosomal protein L27 / 40S ribosomal protein S10 / 60S ribosomal protein L8 / Ribosomal protein L13A / 40S ribosomal protein S7 / Guanine nucleotide binding protein beta subunit / 60S ribosomal protein L13 / Uncharacterized protein / 40S ribosomal protein S13 / 60S ribosomal protein L31
Similarity search - Component
Biological speciesSpraguea lophii 42_110 (fungus)
MethodELECTRON MICROSCOPY / subtomogram averaging / cryo EM / Resolution: 14.3 Å
AuthorsGil Diez, P. / McLaren, M. / Isupov, M.N. / Daum, B. / Conners, R. / Williams, B.
Funding support United Kingdom, 1items
OrganizationGrant numberCountry
Wellcome Trust212439/Z/18/Z United Kingdom
CitationJournal: Nat Microbiol / Year: 2023
Title: CryoEM reveals that ribosomes in microsporidian spores are locked in a dimeric hibernating state.
Authors: Mathew McLaren / Rebecca Conners / Michail N Isupov / Patricia Gil-Díez / Lavinia Gambelli / Vicki A M Gold / Andreas Walter / Sean R Connell / Bryony Williams / Bertram Daum /
Abstract: Translational control is an essential process for the cell to adapt to varying physiological or environmental conditions. To survive adverse conditions such as low nutrient levels, translation can be ...Translational control is an essential process for the cell to adapt to varying physiological or environmental conditions. To survive adverse conditions such as low nutrient levels, translation can be shut down almost entirely by inhibiting ribosomal function. Here we investigated eukaryotic hibernating ribosomes from the microsporidian parasite Spraguea lophii in situ by a combination of electron cryo-tomography and single-particle electron cryo-microscopy. We show that microsporidian spores contain hibernating ribosomes that are locked in a dimeric (100S) state, which is formed by a unique dimerization mechanism involving the beak region. The ribosomes within the dimer are fully assembled, suggesting that they are ready to be activated once the host cell is invaded. This study provides structural evidence for dimerization acting as a mechanism for ribosomal hibernation in microsporidia, and therefore demonstrates that eukaryotes utilize this mechanism in translational control.
History
DepositionMay 24, 2023Deposition site: PDBE / Processing site: PDBE
Revision 1.0Jun 21, 2023Provider: repository / Type: Initial release
Revision 1.1Aug 2, 2023Group: Data processing / Database references / Refinement description
Category: em_3d_reconstruction / pdbx_database_related / refine
Item: _em_3d_reconstruction.resolution / _refine.ls_d_res_high
Revision 1.2Sep 6, 2023Group: Data collection / Category: chem_comp_atom / chem_comp_bond / em_obsolete
Revision 1.3Dec 20, 2023Group: Database references / Category: citation / citation_author
Item: _citation.country / _citation.journal_abbrev ..._citation.country / _citation.journal_abbrev / _citation.journal_id_CSD / _citation.journal_id_ISSN / _citation.journal_volume / _citation.page_first / _citation.page_last / _citation.pdbx_database_id_DOI / _citation.pdbx_database_id_PubMed / _citation.title / _citation.year

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
L50: RNA 28S
L70: RNA 5S
LA0: 60S ribosomal protein L8
LAA: Ribosomal protein L18e/L15P
LB0: 60S ribosomal protein L3
LC0: 60S ribosomal protein L4
LCC: 60S ribosomal protein L3
LD0: 60S ribosomal protein L5
LDD: 60S ribosomal protein L31
LE0: 60S ribosomal protein L6
LEE: 60S ribosomal protein L32
LF0: 60S ribosomal protein L7
LFF: 60S ribosomal protein L35a
LG0: 60S ribosomal protein L8
LGG: Ribosomal protein L34
LH0: 60S ribosomal protein L9
LHH: Ribosomal L29 protein
LI0: S60 ribosomal protein L10
LII: 60S ribosomal protein L36
LJ0: 60S ribosomal protein L11
LJJ: 60S ribosomal protein L37
LL0: 60S ribosomal protein L13
LLL: 60S ribosomal protein L39
LM0: Transposase
LMM: Ubiquitin
LN0: Ribosomal protein L15
LO0: Ribosomal protein L13A
LOO: 60S ribosomal protein L44
LP0: 60S ribosomal protein L17
LPP: 60S ribosomal protein L37a
LQ0: 60S ribosomal protein L18
LR0: 60S ribosomal protein L19
LS0: 60S ribosomal protein L20
LT0: 60s ribosomal protein L21
LU0: 60S ribosomal protein L22
LV0: Ribosomal protein L23
LW0: Ribosomal protein L24E
LX0: 60S ribosomal protein L23a
LY0: 60S ribosomal protein L26
LZ0: 60S ribosomal protein L27
MD1: DNL-type domain-containing protein
S60: RNA 16S
SA0: 40S ribosomal protein S0
SAA: 40S ribosomal protein S26
SB0: 40S ribosomal protein S1
SBB: 40S ribosomal protein S27
SC0: 40S ribosomal protein S2
SCC: 40S ribosomal protein S28
SD0: 40S ribosomal protein S3
SDD: 40S ribosomal protein S29
SE0: 40S ribosomal protein S4
SEE: 40S ribosomal protein S30
SF0: 40S ribosomal protein S5
SFF: Ubiquitin/40s ribosomal protein S27a fusion
SG0: 40S ribosomal protein S6
SGG: Guanine nucleotide binding protein beta subunit
SH0: 40S ribosomal protein S7
SI0: 40S ribosomal protein S8
SJ0: 40S ribosomal protein S9
SK0: 40S ribosomal protein S10
SL0: 40S ribosomal protein S11
SM0: 40S ribosomal protein S12
SN0: 40S ribosomal protein S13
SO0: 40S ribosomal protein S14
SQ0: 40S ribosomal protein S16
SR0: 40S ribosomal protein S17
SS0: 40S ribosomal protein S18
ST0: 40S Ribosomal protein S19
SU0: 40S ribosomal protein S20
SV0: Ribosomal protein S21E
SW0: 40S ribosomal protein S15A
SX0: Ribosomal protein S12/S23
SY0: 40s ribosomal protein s24
SZ0: 40S ribosomal protein S25
K50: RNA 28S
K70: RNA 5S
KA0: 60S ribosomal protein L8
KAA: Ribosomal protein L18e/L15P
KB0: 60S ribosomal protein L3
KC0: 60S ribosomal protein L4
KCC: 60S ribosomal protein L3
KD0: 60S ribosomal protein L5
KDD: 60S ribosomal protein L31
KE0: 60S ribosomal protein L6
KEE: 60S ribosomal protein L32
KF0: 60S ribosomal protein L7
KFF: 60S ribosomal protein L35a
KG0: 60S ribosomal protein L8
KGG: Ribosomal protein L34
KH0: 60S ribosomal protein L9
KHH: Ribosomal L29 protein
KI0: S60 ribosomal protein L10
KII: 60S ribosomal protein L36
KJ0: 60S ribosomal protein L11
KJJ: 60S ribosomal protein L37
KL0: 60S ribosomal protein L13
KLL: 60S ribosomal protein L39
KM0: Transposase
KMM: Ubiquitin
KN0: Ribosomal protein L15
KO0: Ribosomal protein L13A
KOO: 60S ribosomal protein L44
KP0: 60S ribosomal protein L17
KPP: 60S ribosomal protein L37a
KQ0: 60S ribosomal protein L18
KR0: 60S ribosomal protein L19
KS0: 60S ribosomal protein L20
KT0: 60s ribosomal protein L21
KU0: 60S ribosomal protein L22
KV0: Ribosomal protein L23
KW0: Ribosomal protein L24E
KX0: 60S ribosomal protein L23a
KY0: 60S ribosomal protein L26
KZ0: 60S ribosomal protein L27
MD2: DNL-type domain-containing protein
R60: RNA 16S
RA0: 40S ribosomal protein S0
RAA: 40S ribosomal protein S26
RB0: 40S ribosomal protein S1
RBB: 40S ribosomal protein S27
RC0: 40S ribosomal protein S2
RCC: 40S ribosomal protein S28
RD0: 40S ribosomal protein S3
RDD: 40S ribosomal protein S29
RE0: 40S ribosomal protein S4
REE: 40S ribosomal protein S30
RF0: 40S ribosomal protein S5
RFF: Ubiquitin/40s ribosomal protein S27a fusion
RG0: 40S ribosomal protein S6
RGG: Guanine nucleotide binding protein beta subunit
RH0: 40S ribosomal protein S7
RI0: 40S ribosomal protein S8
RJ0: 40S ribosomal protein S9
RK0: 40S ribosomal protein S10
RL0: 40S ribosomal protein S11
RM0: 40S ribosomal protein S12
RN0: 40S ribosomal protein S13
RO0: 40S ribosomal protein S14
RQ0: 40S ribosomal protein S16
RR0: 40S ribosomal protein S17
RS0: 40S ribosomal protein S18
RT0: 40S Ribosomal protein S19
RU0: 40S ribosomal protein S20
RV0: Ribosomal protein S21E
RW0: 40S ribosomal protein S15A
RX0: Ribosomal protein S12/S23
RY0: 40s ribosomal protein s24
RZ0: 40S ribosomal protein S25
SP0: Ribosomal protein S19
RP0: Ribosomal protein S19
hetero molecules


Theoretical massNumber of molelcules
Total (without water)5,294,197168
Polymers5,293,020150
Non-polymers1,17718
Water0
1


  • Idetical with deposited unit
  • defined by author
  • Evidence: electron microscopy, not applicable
TypeNameSymmetry operationNumber
identity operation1_5551

-
Components

-
RNA chain , 3 types, 6 molecules L50K50L70K70S60R60

#1: RNA chain RNA 28S


Mass: 849039.812 Da / Num. of mol.: 2 / Source method: isolated from a natural source
Details: ...Details: CCACACACAAGGGAUCGUUUGGCUCCUGGGACGAGGAAGGGCGCAGCAGAGAGCGAUAUGUGUGGGAGCAGCAAGCAAUGACCACACGUCCCCGAAUACAGCAUAGUGCUGGAGUACUCCUUGGAAUUAAGCAUAUGAGUAAAGGAAGGAAAAGAAACUAACGAGGAUUCCCGUAGUAGCGGCGAGUGAACAGGGAACAGUCCAACAGUGUAAUUCUCAAAUGAGAAGUUGUCAAAAGGAAGAAGAUGUGAAUCAGAAAGAAAAGCUGAACGAUACAGGGUGAUAGUCCCGUAGUGUCUUCUUACAUACGGUGAGUAGCUGUGCUCGGUAAUGCACAGUGAAGAGGUGGCAGUGUGCAUCUAAGACUAAAUACAACAGGAGACCGAUAGCAAAGAAGUAGGUUGACCGAAAACAUCUAAGUGAAAUUGUGUGUGGACCCGAAUGGAUCGGGCCCGUCUUGAAACACGGACCAAGGAGUGCACAUACACUGCAAGUUGAGCAGAGGAAGUCUGUGAGGCGUAGUGAAGACGGAAAGCAGUGUGAGUGCGACCCGAUAGACUUGUGAACUAUACCUUGUUGCUGUGAAGGCUGGCGAAAGCCAGCUGGAGGCGGCAAGCCGUAUUGAUCUGCAAAUCAUUGGCGUAAGCAGGGUAUAGGGGCGAAAGACCAAUCGAACAGUCUAGUUGCUGGUUCCCUCCGAAAUGUCUAUCAGGACAGCGCGCACGCAGAGAGAAGCAAGGUAGAGCAUGGGCCGGUAUCCUUAAGGAGACGGACGAACUGCGAAUGUGCUUUUCUUCUAUGCAAGCGUAGUGGGCGAGUUCUGGUAAGCAGGACUGGCGAAGAGGAAUGAACCUGGCACUGUGCUAAGGAACCCAAUGUCUGGACAGAGACCGAAAGAGGUAGGUGAAUAAGGACGGUAGGGCGGUAGCCAUGGAAGUCGGCAUCCGGUAAGAAACGUGUUACAACGUACCUACGGAAUUCAUCUGCUCUGAAAAUUGAUGGCGCUUACCAGACAUCCGAUGCACAGUUAGCAGGUAGGAGGGCGUGUGUCUACUGGCGAAGGUACCGAGUGAUCGGUGGUGGAGGUAGAUGCAGAGCAGAUCUUGGUGGUAGUAGCGAUAAUUUGUCUUCAGCGGCAAAGACUGAGGAGGAGAAGGGUUUCUUCUCAUAAGAAGAGUGAGCCGGGUCUAAGCGAGUGUGUAGAAGCAUGAGCGAAGGAGAAACAGGUUGAUAUUCCUGUGCCUGUGCUGUCGUACGGCAACGUGUAUUAGCUUGUCGACACGAACAUCUAGACAAAGCAGAAACACCUUUUCUGUUCAAGGGGAAAAAGACCACUGAGACGGAUCAUCUGGCGACGUGGUUUUAUAUCUGUGACCAGGCCUGAGCCUGGUUUGUUGAGGAUGGUCGUCCAUGAAAAGACAACUAUAUGGCAGCACAGUCCGUACCAACCGUAUCAGGACUCCAAGGUGAAGAGCCUCUAGUGGAUGUUUUACACAUGUAAGGGAAUUCGGCAAAAUGGAUGCGUAACUUCGGGAGAAGUAUUGGUUCAAUUGUGAACUCAUUGUGACAAGGGGAAUCUGACUGUUUAGUAAAAACAUAGCUUCAUGAAGAGAGAUGAAGUGAGUUCUGCCCGGUGCUCGGUCGUGACACGGAGGAAAUGCCAGAAAGCACGGGUUAACGGCGGGAGUAACUAUGACUCUCUUAAGGUAGCCAAACGCCUCGUCAUUUAAAUGGUGACGCGCAUGAAUGGAAUGACGAGAUUCCCACUGUCCCUACAUGUAGACUAGCGAACCCAUUUCCAGGGGAACGGGCCUGGACGGCCAGCGGGGAAAGAAGACCCUGUUGAGCUUGACUCUAGUGUGGCCAAGUUGUGACGAUUGAGGCGAUGUAGGAAGGUGGAGAGCGCAAGCAGAAGUGAAAGACCACUGCGCCAUGAUCAUCACGACACACUUGUUUAAGGACAAAGGCCAGAUGGGGAGUUUGGCUGGGGCGGUACGACCACAGAAUCAGAACGUGGUCGACCGAAGGUACUCACAGCGAGACGAGAACACUCGUGUAGAGCAUAAGGACUAAAGAGUGCCUGAGUGUGAGCACUACUGCUUGCAUGAGGGGAAACCCGGGCCUAGCGAUCCUACGCAUACGAGACACUUGUGGCGUGGGUGUCAGAAAAGUUACCACAGGGAUAACUGGCUUGUGGCCGCCGAGCGUAGAAAGCGACGCGGCUUUUUGAUUCUUCGAUGUCGGCUCUUCCUAGCAUGGCCAUGCAGCCGUGGCGAAGUGUUGGAUUGUUCACCCACUAACAGGGAACGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUUAGUUUUAUCCUACUGUCCAAACAGUUGAAGGGAGUGUGGAUUAGUACGAAAGGAAACCCACACGUGACCUCUGGUGCAGCGGGUGUGCGGAAGUGCAACUGCCAUGCUACGUCUCCUCAAGCAUAGCUGGAAGCCUCUAAGCUAGAAAUGAGUCCUGACUCUGGAAGACGGCCGGGAAGACGACCCGUAGUUAACAGCGGUGUUGUACGAUAUGAGCUUUCUAUUUGUGUAGUAGCGAGUAUUUGAGACACUGGUUGUUACCACCGUCGUUUAUU
Source: (natural) Spraguea lophii 42_110 (fungus)
#2: RNA chain RNA 5S


Mass: 38356.801 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus)
#42: RNA chain RNA 16S


Mass: 444812.531 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus)

+
60S ribosomal protein ... , 28 types, 56 molecules LA0KA0LB0KB0LC0KC0LCCKCCLD0KD0LDDKDDLE0KE0LEEKEELF0KF0LFFKFFLG0KG0LH0KH0LIIKIILJ0KJ0LJJKJJ...

#3: Protein 60S ribosomal protein L8 /


Mass: 27005.500 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus)
#5: Protein 60S ribosomal protein L3 /


Mass: 44320.641 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XFB1
#6: Protein 60S ribosomal protein L4 /


Mass: 37241.633 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7WCM8
#7: Protein 60S ribosomal protein L3 /


Mass: 12484.438 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7WAY0
#8: Protein 60S ribosomal protein L5 /


Mass: 33892.250 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XIG7
#9: Protein 60S ribosomal protein L31 /


Mass: 12854.213 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XW48
#10: Protein 60S ribosomal protein L6 /


Mass: 20220.115 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W5S3
#11: Protein 60S ribosomal protein L32 /


Mass: 16075.998 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XKE0
#12: Protein 60S ribosomal protein L7 /


Mass: 27935.564 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W946
#13: Protein 60S ribosomal protein L35a /


Mass: 12757.991 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W662
#14: Protein 60S ribosomal protein L8 /


Mass: 23604.990 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XU63
#16: Protein 60S ribosomal protein L9 /


Mass: 21538.230 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XRZ9
#19: Protein 60S ribosomal protein L36 /


Mass: 11350.697 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7WED1
#20: Protein 60S ribosomal protein L11 /


Mass: 19484.965 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7WB69
#21: Protein 60S ribosomal protein L37 / / eL37


Mass: 10517.657 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus)
#22: Protein 60S ribosomal protein L13 /


Mass: 19513.141 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XVM9
#23: Protein 60S ribosomal protein L39 /


Mass: 6227.581 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XTP1
#28: Protein 60S ribosomal protein L44 /


Mass: 11990.510 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XL20
#29: Protein 60S ribosomal protein L17 /


Mass: 19114.490 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7WDR4
#30: Protein 60S ribosomal protein L37a /


Mass: 10151.127 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus)
#31: Protein 60S ribosomal protein L18 /


Mass: 21378.133 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7WAI2
#32: Protein 60S ribosomal protein L19 /


Mass: 19549.994 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7WBY9
#33: Protein 60S ribosomal protein L20 /


Mass: 20043.385 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7WAG4
#34: Protein 60s ribosomal protein L21 /


Mass: 18344.420 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W8F6
#35: Protein 60S ribosomal protein L22 /


Mass: 12854.773 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W958
#38: Protein 60S ribosomal protein L23a /


Mass: 12557.947 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XFW8
#39: Protein 60S ribosomal protein L26 /


Mass: 15026.874 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W884
#40: Protein 60S ribosomal protein L27 /


Mass: 18247.842 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XU08

-
Ribosomal protein ... , 9 types, 18 molecules LAAKAALGGKGGLN0KN0LO0KO0LV0KV0LW0KW0SV0RV0SX0RX0SP0RP0

#4: Protein Ribosomal protein L18e/L15P / Ribosome / uL15


Mass: 16609.498 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus)
#15: Protein Ribosomal protein L34 /


Mass: 12020.348 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W7C6
#26: Protein Ribosomal protein L15 /


Mass: 24200.426 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W7A2
#27: Protein Ribosomal protein L13A / Ribosome


Mass: 22885.139 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XUD8
#36: Protein Ribosomal protein L23 /


Mass: 15239.987 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XLC4
#37: Protein Ribosomal protein L24E / Ribosome


Mass: 15342.161 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XSY2
#70: Protein Ribosomal protein S21E / Ribosome


Mass: 7768.887 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7WAC1
#72: Protein Ribosomal protein S12/S23 / Ribosome / uS12


Mass: 15822.722 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus)
#75: Protein Ribosomal protein S19 / 40S ribosomal protein S19


Mass: 18514.629 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XKY9

-
Protein , 7 types, 14 molecules LHHKHHLI0KI0LM0KM0LMMKMMMD1MD2SFFRFFSGGRGG

#17: Protein Ribosomal L29 protein


Mass: 14183.866 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus)
#18: Protein S60 ribosomal protein L10


Mass: 25142.328 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7WBF8
#24: Protein Transposase /


Mass: 13258.343 Da / Num. of mol.: 2 / Source method: isolated from a natural source
Details: MYFIKPGCLIKKKFSIYTSIVISVIDNNSVVIQSYDKSDNGDVISIDREVINVSKIVPIGNIDIKNKSKKEIDGILVEENRNLKNKDDVLLMNDFERFKEQLKKEVEDMVIEEMA
Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XVN9
#25: Protein Ubiquitin /


Mass: 14563.868 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XSQ3
#41: Protein DNL-type domain-containing protein


Mass: 17595.088 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W5K5
#54: Protein Ubiquitin/40s ribosomal protein S27a fusion


Mass: 16937.791 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W9X5
#56: Protein Guanine nucleotide binding protein beta subunit


Mass: 36182.824 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XVG3

+
40S ribosomal protein ... , 28 types, 56 molecules SA0RA0SAARAASB0RB0SBBRBBSC0RC0SCCRCCSD0RD0SDDRDDSE0RE0SEEREESF0RF0SG0RG0SH0RH0SI0RI0SJ0RJ0...

#43: Protein 40S ribosomal protein S0 /


Mass: 26201.186 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W8R1
#44: Protein 40S ribosomal protein S26 /


Mass: 11974.061 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W9M7
#45: Protein 40S ribosomal protein S1 / / eS1


Mass: 25934.658 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus)
#46: Protein 40S ribosomal protein S27 / / eS27


Mass: 9189.923 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus)
#47: Protein 40S ribosomal protein S2 /


Mass: 27241.541 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W7R5
#48: Protein 40S ribosomal protein S28 / / eS28


Mass: 7288.479 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus)
#49: Protein 40S ribosomal protein S3 /


Mass: 27516.459 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7WAW0
#50: Protein 40S ribosomal protein S29 /


Mass: 7891.175 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XJB1
#51: Protein 40S ribosomal protein S4 /


Mass: 31442.154 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XG51
#52: Protein 40S ribosomal protein S30 / / eS30


Mass: 6816.010 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus)
#53: Protein 40S ribosomal protein S5 /


Mass: 21982.785 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W4M9
#55: Protein 40S ribosomal protein S6 /


Mass: 26194.869 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus)
#57: Protein 40S ribosomal protein S7 /


Mass: 19132.023 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XV29
#58: Protein 40S ribosomal protein S8 /


Mass: 19912.068 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XGW2
#59: Protein 40S ribosomal protein S9 /


Mass: 21365.959 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W8E3
#60: Protein 40S ribosomal protein S10 /


Mass: 12702.538 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XU48
#61: Protein 40S ribosomal protein S11 /


Mass: 18109.406 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W8R0
#62: Protein 40S ribosomal protein S12 /


Mass: 14343.721 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W7D2
#63: Protein 40S ribosomal protein S13 /


Mass: 16191.990 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XVZ9
#64: Protein 40S ribosomal protein S14 /


Mass: 14708.000 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W6I0
#65: Protein 40S ribosomal protein S16 /


Mass: 16415.074 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7WDU9
#66: Protein 40S ribosomal protein S17 / / eS17


Mass: 14055.251 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus)
#67: Protein 40S ribosomal protein S18 /


Mass: 18171.129 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XJA1
#68: Protein 40S Ribosomal protein S19 /


Mass: 16603.318 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W7P5
#69: Protein 40S ribosomal protein S20 /


Mass: 13777.075 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W986
#71: Protein 40S ribosomal protein S15A /


Mass: 14620.056 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7XK92
#73: Protein 40s ribosomal protein s24 /


Mass: 17189.895 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7W8J5
#74: Protein 40S ribosomal protein S25 /


Mass: 14777.071 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) Spraguea lophii 42_110 (fungus) / References: UniProt: S7WAV8

-
Non-polymers , 1 types, 18 molecules

#76: Chemical
ChemComp-ZN / ZINC ION


Mass: 65.409 Da / Num. of mol.: 18 / Source method: obtained synthetically / Formula: Zn / Feature type: SUBJECT OF INVESTIGATION

-
Details

Has ligand of interestY

-
Experimental details

-
Experiment

ExperimentMethod: ELECTRON MICROSCOPY
EM experimentAggregation state: PARTICLE / 3D reconstruction method: subtomogram averaging

-
Sample preparation

ComponentName: Ribosome / Type: RIBOSOME / Entity ID: #1-#75 / Source: NATURAL
Source (natural)Organism: Spraguea lophii 42_110 (fungus)
Buffer solutionpH: 7.5
SpecimenEmbedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES
Specimen supportDetails: 20 mA, Carbon coated grid / Grid material: COPPER / Grid mesh size: 300 divisions/in. / Grid type: Quantifoil
VitrificationInstrument: FEI VITROBOT MARK IV / Cryogen name: ETHANE / Humidity: 100 % / Chamber temperature: 288.15 K / Details: blot force -1 and blot time 4 s

-
Electron microscopy imaging

Experimental equipment
Model: Titan Krios / Image courtesy: FEI Company
MicroscopyModel: FEI TITAN KRIOS
Electron gunElectron source: FIELD EMISSION GUN / Accelerating voltage: 300 kV / Illumination mode: FLOOD BEAM
Electron lensMode: BRIGHT FIELDBright-field microscopy / Nominal defocus max: 6000 nm / Nominal defocus min: 2500 nm / Cs: 2.7 mm
Specimen holderCryogen: NITROGEN / Specimen holder model: FEI TITAN KRIOS AUTOGRID HOLDER
Image recording
IDImaging-IDElectron dose (e/Å2)Avg electron dose per subtomogram (e/Å2)Detector modeFilm or detector model
111.98120COUNTINGGATAN K2 SUMMIT (4k x 4k)
211.98120GATAN K3 BIOQUANTUM (6k x 4k)

-
Processing

EM software
IDNameVersionCategory
1IMOD4.12.10volume selection
2Warp1.1.0volume selection
3SerialEMimage acquisition
5Warp1.1.0CTF correction
8Cootmodel fitting
9UCSF ChimeraXmodel fitting
11REFMACmodel refinement
13RELION3.1final Euler assignment
15RELION3.13D reconstruction
16Warp1.1.03D reconstruction
CTF correctionType: PHASE FLIPPING AND AMPLITUDE CORRECTION
SymmetryPoint symmetry: C2 (2 fold cyclic)
3D reconstructionResolution: 14.3 Å / Resolution method: FSC 0.143 CUT-OFF / Num. of particles: 1344 / Symmetry type: POINT
EM volume selectionNum. of tomograms: 20 / Num. of volumes extracted: 6505
Atomic model buildingProtocol: RIGID BODY FIT / Space: RECIPROCAL
RefinementHighest resolution: 14.3 Å

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242)：Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more